DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_RHYAM (Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.764e-41
Identity = 78/119 (65.55%), Postives = 97/119 (81.51%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K +P + A NFT+QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K+DRRSGK  E  PK +K+GDA +V + P+KP+ VE+F ++PPLGRFAVRDMRQTVAVGVIK+V  KD TG
Sbjct:  279 KANPPKGAENFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKXKVDRRSGKSTEDNPKAIKSGDAAIVILQPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVVFKDATG 397          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_BOMMO (Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.095e-40
Identity = 75/119 (63.03%), Postives = 98/119 (82.35%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K++P + AA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K+DRR+GK  E  PK +K+GDA +V ++P+KP+ VE+F ++PPLGRFAVRDMRQTVAVGVIK V  K+  G
Sbjct:  330 KNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAGG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_EUPCR (Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.211e-39
Identity = 74/115 (64.35%), Postives = 93/115 (80.87%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+DPA    +F S  I+MNHPG+I  GY PV+DCHT+HIA KF EL+TK D+RSGK  E+ PKFLK GDAG++++ P+KP+ VETF+ Y PLGRFAVRDMRQTVAVGVI+ ++KK
Sbjct:  318 KNDPATDTESFVSHTIVMNHPGEIKAGYTPVIDCHTAHIACKFEELLTKADKRSGKMTEENPKFLKAGDAGLIRLSPSKPLCVETFATYAPLGRFAVRDMRQTVAVGVIQEIKKK 432          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PLAFK (Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.697e-39
Identity = 70/116 (60.34%), Postives = 98/116 (84.48%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD 409
            K++PA+  + FT+QVII+NHPG+I NGY P+LDCHTSHI+ KF  + +KID+RSGK +E+ PK +K+GD+ +V + P KPMVVETF++YPPLGRFA+RDMRQT+AVG+I  +++K+
Sbjct:  316 KNEPAKGCSKFTAQVIILNHPGEIKNGYTPLLDCHTSHISCKFLNIDSKIDKRSGKVVEENPKAIKSGDSALVSLEPKKPMVVETFTEYPPLGRFAIRDMRQTIAVGIINQLKRKN 431          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ENTHI (Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.697e-39
Identity = 75/113 (66.37%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELE-KEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNV 397
            K+ PA    +FT+QVI+MNHPGQI  GY PVLDCHTSHIA KF EL++KIDRR+GK +E  EP+++KNGD+ +VK++PTKP+ VE F+ +PPLGRFAVRDM+QTVAVGV+K V
Sbjct:  316 KNQPAVGCEDFTAQVIVMNHPGQIRKGYTPVLDCHTSHIACKFEELLSKIDRRTGKSMEGGEPEYIKNGDSALVKIVPTKPLCVEEFAKFPPLGRFAVRDMKQTVAVGVVKAV 428          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_DICDI (Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 5.087e-38
Identity = 80/137 (58.39%), Postives = 104/137 (75.91%), Query Frame = 2
Query:   17 KNV-LQGSQRGL-CXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPK---FLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 412
            KNV ++  +RG+     K+DP +    F +QVI++NHPGQI  GY+PVLDCHT+HIA KF+E+V K+DRR+G  + KE      LKNGDA MV++ P++PM VE+F++YPPLGRFAVRDMRQTVAVGVIK+  KK P
Sbjct:  301 KNVSVKEIKRGMVAGDSKNDPPQETEKFVAQVIVLNHPGQIHAGYSPVLDCHTAHIACKFTEIVDKVDRRTGAVVAKEGTAAVVLKNGDAAMVELTPSRPMCVESFTEYPPLGRFAVRDMRQTVAVGVIKSTVKKAP 437          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_XENLA (Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 153.68 bits (387), Expect = 9.593e-37
Identity = 74/130 (56.92%), Postives = 97/130 (74.62%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K++ +G+  G     K DP   A++FT+QVII+NHPG I  GY+PV+DCHT+HI  +F+EL  KIDRR+GK+LE  P  LK+GDA ++ + P KP  VE F DYPPLGRFA RD++QTVAVGV+K+VE K
Sbjct:  321 KSLKRGNVAG---NSKSDPPTEASSFTAQVIILNHPGFIKAGYSPVIDCHTAHITCQFAELQEKIDRRTGKKLEDNPGLLKSGDAAIITLKPIKPFCVERFFDYPPLGRFAARDLKQTVAVGVVKSVEHK 447          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_EUPCR (Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.363e-35
Identity = 68/123 (55.28%), Postives = 93/123 (75.61%), Query Frame = 2
Query:   47 LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPT 415
            +C   K+DP + A +F +QVI+MNHPG I  GY PVLD HT+H+A KF  L++K + R+GK +E+ PKFLKNG++G+V+++PTKP+ VE FS Y  LGRF +RDM++TVAVGVI+ V  K  T
Sbjct:  310 VCGDAKNDPPKNAESFIAQVIVMNHPGHIKAGYQPVLDIHTAHVATKFKTLLSKNEARTGKLIEEAPKFLKNGESGIVELVPTKPLCVEEFSKYAALGRFVIRDMKRTVAVGVIQEVIHKKET 432          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_BLAHO (Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.820e-34
Identity = 66/116 (56.90%), Postives = 90/116 (77.59%), Query Frame = 2
Query:   47 LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKN 394
            +C   K+DP     +  +QVI+MNHP  I  GY PV+DCHT+HIA KF ++++++D+R+GK L + P  +KNG + M +++P+KPM VETFSDYPPLGRFAVRDMRQTVAVG+IK+
Sbjct:  315 VCGDAKNDPPCKTES-DAQVIVMNHPSGIRPGYCPVVDCHTAHIACKFEKIMSEMDKRTGKVLRENPDIVKNGKSMMAQLVPSKPMCVETFSDYPPLGRFAVRDMRQTVAVGIIKS 429          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_SPOFR (Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.772e-33
Identity = 60/98 (61.22%), Postives = 82/98 (83.67%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVR 355
            K++P + AA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K+DRR+GK  E  PK +K+GDA +V ++P+KP+ VE+F ++PPLGRFAVR
Sbjct:  316 KNNPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVR 413          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A_RHYAM3.764e-4165.55Elongation factor 1-alpha (Fragment) OS=Rhynchosci... [more]
EF1A_BOMMO1.095e-4063.03Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1[more]
EF1A1_EUPCR1.211e-3964.35Elongation factor 1-alpha 1 OS=Euplotes crassus GN... [more]
EF1A_PLAFK2.697e-3960.34Elongation factor 1-alpha OS=Plasmodium falciparum... [more]
EF1A_ENTHI2.697e-3966.37Elongation factor 1-alpha OS=Entamoeba histolytica... [more]
EF1A_DICDI5.087e-3858.39Elongation factor 1-alpha OS=Dictyostelium discoid... [more]
EF1A1_XENLA9.593e-3756.92Elongation factor 1-alpha OS=Xenopus laevis PE=1 S... [more]
EF1A2_EUPCR2.363e-3555.28Elongation factor 1-alpha 2 OS=Euplotes crassus GN... [more]
EF1A_BLAHO5.820e-3456.90Elongation factor 1-alpha OS=Blastocystis hominis ... [more]
EF1A_SPOFR3.772e-3361.22Elongation factor 1-alpha (Fragment) OS=Spodoptera... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top