DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_RAT (Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.018e-104
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVPISG+ GDNM+E S N+ W+K            G +LL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_RABIT (Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.018e-104
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVPISG+ GDNM+E S N+ W+K            G +LL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_MOUSE (Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.018e-104
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVPISG+ GDNM+E S N+ W+K            G +LL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_HUMAN (Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.018e-104
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVPISG+ GDNM+E S N+ W+K            G +LL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_BOVIN (Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.018e-104
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVPISG+ GDNM+E S N+ W+K            G +LL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ONCVO (Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.636e-104
Identity = 184/250 (73.60%), Postives = 208/250 (83.20%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGI IDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+AR+ E+  EVS+Y+KK+GYNP+ +PFVPISGF GDNM+E S N+ W+K            G TLL+ALD++  P+RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGM VTF P  LTTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGIQIDIALWKFETPKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTDPPFSEARFGEVTTEVSNYIKKIGYNPKSIPFVPISGFNGDNMLEPSANMPWFKGWSVERKEGTMTGKTLLEALDSVVPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMIVTFAPQNLTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A3_OSCTI (Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 3.443e-104
Identity = 186/250 (74.40%), Postives = 208/250 (83.20%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R+DEIV EV S+LKKVGYNP  +PFVPISGF GDNM+E S+N+ WYK            G TL++ALD I  P+RP+D+PLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P  +TTEV
Sbjct:   41 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFDEIVTEVKSFLKKVGYNPATIPFVPISGFNGDNMLEPSSNMSWYKGWSVERKEGNASGKTLIEALDCIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPQNVTTEV 290          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_SORMA (Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 5.873e-104
Identity = 188/250 (75.20%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  ++S+AR++EI+KE  +++KKVGYNP  V FVPISGF GDNM+E STN  WYK            G TLL+A+D I +PKRP+DKPLRLPLQDVYKIGGIGTVPVGR+ETGVLKPGM VTF PS +TTEV
Sbjct:   41 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--QWSQARFEEIIKETKNFIKKVGYNPATVAFVPISGFNGDNMLEASTNCPWYKGWEKETKAGKSTGKTLLEAIDAIEQPKRPTDKPLRLPLQDVYKIGGIGTVPVGRIETGVLKPGMVVTFAPSNVTTEV 288          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_COCIM (Elongation factor 1-alpha OS=Coccidioides immitis GN=TEF PE=2 SV=2)

HSP 1 Score: 376.326 bits (965), Expect = 1.002e-103
Identity = 189/250 (75.60%), Postives = 212/250 (84.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA E+ K+SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLAFTLGVKQ+I   NKMD+T   +S+ R++EIVKEVS+++KKVGYNP+ VPFVPISGFEGDNMI+ STN  WYK            G TLLDA+D I+ P RP++KPLRLPLQDVYKI GIGTVPVGRVETGV+KPGM VTF PS +TTEV
Sbjct:   41 EKFEKEAEELGKKSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAFTLGVKQLIVAINKMDST--NWSEPRFNEIVKEVSNFIKKVGYNPKAVPFVPISGFEGDNMIQPSTNAPWYKGWNKETASGKHSGKTLLDAIDAIDPPTRPTEKPLRLPLQDVYKISGIGTVPVGRVETGVIKPGMVVTFAPSNVTTEV 288          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_CHICK (Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 1.002e-103
Identity = 187/250 (74.80%), Postives = 211/250 (84.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S+N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSSNMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A2_RAT2.018e-10474.80Elongation factor 1-alpha 2 OS=Rattus norvegicus G... [more]
EF1A2_RABIT2.018e-10474.80Elongation factor 1-alpha 2 OS=Oryctolagus cunicul... [more]
EF1A2_MOUSE2.018e-10474.80Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef... [more]
EF1A2_HUMAN2.018e-10474.80Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF... [more]
EF1A2_BOVIN2.018e-10474.80Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A... [more]
EF1A_ONCVO2.636e-10473.60Elongation factor 1-alpha OS=Onchocerca volvulus P... [more]
EF1A3_OSCTI3.443e-10474.40Elongation factor 1-alpha 3 OS=Oscheius tipulae GN... [more]
EF1A_SORMA5.873e-10475.20Elongation factor 1-alpha OS=Sordaria macrospora G... [more]
EF1A_COCIM1.002e-10375.60Elongation factor 1-alpha OS=Coccidioides immitis ... [more]
EF1A_CHICK1.002e-10374.80Elongation factor 1-alpha 1 OS=Gallus gallus GN=EE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top