DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_CRIGR (Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_BOVIN (Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.308e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ORYLA (Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.709e-103
Identity = 188/250 (75.20%), Postives = 208/250 (83.20%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+AR++EI KEVS+Y+KK+GYNP  V FVPISG+ GDNM+E S  + W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF P  LTTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKKIGYNPAAVAFVPISGWHGDNMLEASDKMSWFKGWKIERKDGNASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPPNLTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HYDAT (Elongation factor 1-alpha OS=Hydra attenuata PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.709e-103
Identity = 188/251 (74.90%), Postives = 210/251 (83.67%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK-------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFETTKY  T+IDAPGHRDFIKNMITGTSQADCAVLI+ S+TG FEAGISK+GQTREHALLAFTLGVKQMI   NK+D T P YS+AR++EI KE+S+Y+KKVGY+P+ VP +P+SG+ GDNMIE S N+ WYK             G TLL+ALDNI  P RPS KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGM VTF P+ L+TEV
Sbjct:   41 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKYVVTIIDAPGHRDFIKNMITGTSQADCAVLIVASSTGEFEAGISKNGQTREHALLAFTLGVKQMIVAVNKIDNTEPPYSEARFNEIKKEISAYVKKVGYDPKTVPVLPVSGWHGDNMIEPSPNMSWYKGWEVEYKDTGKHTGKTLLEALDNIPLPARPSSKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFCPANLSTEV 291          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A3_XENLA (Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 375.555 bits (963), Expect = 1.709e-103
Identity = 187/250 (74.80%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P +S+ R++EI KEVS+Y+KK+GYNP  VPFVPISG+ GDNM+E STN+ W+K            G TLL+ALD I  P+RP++KPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM VTF PS +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNMPWFKGWKIERKEGNASGITLLEALDCIIPPQRPTNKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFAPSNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A4_OSCTI (Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.232e-103
Identity = 183/250 (73.20%), Postives = 207/250 (82.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R++EI+ EV S++KK+GYNP  +PFVPISGF GDNM+E S N+ WYK            G TLL+ALD I  P+RP+D+PLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFEEIITEVKSFIKKIGYNPATIPFVPISGFNGDNMLEPSANMSWYKGWSVERKEGNASGKTLLEALDCIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPQNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_OSCTI (Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.232e-103
Identity = 183/250 (73.20%), Postives = 207/250 (82.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R++EI+ EV S++KK+GYNP  +PFVPISGF GDNM+E S N+ WYK            G TLL+ALD I  P+RP+D+PLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFEEIITEVKSFIKKIGYNPATIPFVPISGFNGDNMLEPSANMSWYKGWSVERKEGNASGKTLLEALDCIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPQNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_SCHPO (Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe GN=tef1a PE=1 SV=2)

HSP 1 Score: 375.17 bits (962), Expect = 2.232e-103
Identity = 192/265 (72.45%), Postives = 217/265 (81.89%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV-SLLRCTTSXAGGLP 756
            E+FEKEA E+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCAVLII   TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T   +S+AR++EIVKE S+++KKVG+NP+ VPFVP+SGF+GDNMIE +TN+ WY            KG TLL+A+D+I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P+G+TTEV S+     S   GLP
Sbjct:   40 EKFEKEATELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAVLIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDSIEPPARPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMIVTFAPAGVTTEVKSVEMHHESLDAGLP 302          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A0_XENLA (Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.232e-103
Identity = 186/250 (74.40%), Postives = 210/250 (84.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVPISG+ GDNM+E S N+ W+K            G TLL+ALD I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF P  +TTEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSPNMPWFKGWKITRKEGSGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPVNVTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_TETPY (Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.915e-103
Identity = 180/237 (75.95%), Postives = 201/237 (84.81%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTE 711
            E+FEKE+AE  K SFKYAWVLDKLKAERERGITIDI+LWKFET KY+ T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAGISKDGQTREHALLAFTLGVKQMI C NKMD  T  +S+ RY EI KE+S YLKKVGY P+ +PF+PISGF GDNM+ERSTN  WYKGP L++ALD +  PKRP DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM + F P+ +  E
Sbjct:   41 EKFEKESAEQGKGSFKYAWVLDKLKAERERGITIDISLWKFETAKYHFTIIDAPGHRDFIKNMITGTSQADVAILMIASPQGEFEAGISKDGQTREHALLAFTLGVKQMIVCLNKMDEKTVNFSEERYQEIKKELSDYLKKVGYKPDTIPFIPISGFNGDNMLERSTNAPWYKGPILVEALDALEPPKRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMSIQFAPNKVIAE 277          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A1_CRIGR1.308e-10374.80Elongation factor 1-alpha 1 OS=Cricetulus griseus ... [more]
EF1A1_BOVIN1.308e-10374.80Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A... [more]
EF1A_ORYLA1.709e-10375.20Elongation factor 1-alpha OS=Oryzias latipes GN=ee... [more]
EF1A_HYDAT1.709e-10374.90Elongation factor 1-alpha OS=Hydra attenuata PE=2 ... [more]
EF1A3_XENLA1.709e-10374.80Elongation factor 1-alpha, oocyte form OS=Xenopus ... [more]
EF1A4_OSCTI2.232e-10373.20Elongation factor 1-alpha 4 OS=Oscheius tipulae GN... [more]
EF1A2_OSCTI2.232e-10373.20Elongation factor 1-alpha 2 OS=Oscheius tipulae GN... [more]
EF1A1_SCHPO2.232e-10372.45Elongation factor 1-alpha-A OS=Schizosaccharomyces... [more]
EF1A0_XENLA2.232e-10374.40Elongation factor 1-alpha, somatic form OS=Xenopus... [more]
EF1A_TETPY2.915e-10375.95Elongation factor 1-alpha OS=Tetrahymena pyriformi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top