DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_YARLI (Elongation factor 1-alpha OS=Yarrowia lipolytica GN=TEF PE=2 SV=2)

HSP 1 Score: 368.237 bits (944), Expect = 2.728e-101
Identity = 186/250 (74.40%), Postives = 206/250 (82.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA E+ K SFKYAWVLDKLKAERERGITIDIALWKF+T KYY TVIDAPGHRDFIKNMITGTSQADCA+LII    G FEAGISKDGQTREHALLAFTLGVKQ+I   NKMD+   K+S+ RY+EI KE ++++KKVGYNP+ VPFVPISG+ GDNMIE STN DWY            KG TLL+A+D I  P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+K GM VTF P+ +TTEV
Sbjct:   40 EKFEKEADELGKGSFKYAWVLDKLKAERERGITIDIALWKFQTPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVKQLIVAINKMDSV--KWSQDRYNEICKETANFVKKVGYNPKSVPFVPISGWNGDNMIEASTNCDWYKGWTKETKAGEVKGKTLLEAIDAIEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKAGMVVTFAPANVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_SCHCO (Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 3.563e-101
Identity = 186/250 (74.40%), Postives = 206/250 (82.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+L I   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S+ R++EIVKE S+++KKVGYNP+ V FVPISG+ GDNM+E STN+ WY            KG TLLDA+D I  P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++K GM VTF PS +TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILTIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KWSEDRFNEIVKETSTFIKKVGYNPKTVAFVPISGWHGDNMLEESTNMPWYKGWTKETKAGVVKGKTLLDAIDAIEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVVTFAPSNVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_APIME (Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 7.937e-101
Identity = 185/250 (74.00%), Postives = 203/250 (81.20%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD T P YS+AR++EI KEVSSY+KK+GYN   V FVPISG+ GDNM+E S    WYK            G TL++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPGM VTF P+ LTTEV
Sbjct:   40 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGIGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSYIKKIGYNTASVAFVPISGWHGDNMLEPSPKTPWYKGWKVERKDGNADGKTLIEALDAILPPSRPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGMLVTFAPAALTTEV 289          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PIRIN (Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.037e-100
Identity = 190/267 (71.16%), Postives = 213/267 (79.78%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK--------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV-SLLRCTTSXAGGLP 756
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWK ET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T   +S+AR++EIVKE S+++KKVGYNP+ V FVPISG+ GDNM+E STN+ WYK              G TL+DA+D I  P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM V+F PS +TTEV S+       A GLP
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKSETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--NWSEARFNEIVKETSNFIKKVGYNPKTVAFVPISGWHGDNMLEPSTNMPWYKGWSKEVKGSSSPATGKTLVDAIDAIEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVSFAPSNVTTEVKSVEMHHEQLAEGLP 304          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HELZE (Elongation factor 1-alpha (Fragment) OS=Heliothis zea PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HELVI (Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HELGL (Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HELDI (Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HELAM (Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_HELAL (Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_YARLI2.728e-10174.40Elongation factor 1-alpha OS=Yarrowia lipolytica G... [more]
EF1A_SCHCO3.563e-10174.40Elongation factor 1-alpha OS=Schizophyllum commune... [more]
EF1A_APIME7.937e-10174.00Elongation factor 1-alpha OS=Apis mellifera PE=3 S... [more]
EF1A_PIRIN1.037e-10071.16Elongation factor 1-alpha OS=Piriformospora indica... [more]
EF1A_HELZE1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Heliothis ... [more]
EF1A_HELVI1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Heliothis ... [more]
EF1A_HELGL1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Helicoverp... [more]
EF1A_HELDI1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Heliocheil... [more]
EF1A_HELAM1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Helicoverp... [more]
EF1A_HELAL1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Heliocheil... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top