DC900195

Overview
NameDC900195
Unique NameDC900195
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:218..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ANIIF (Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_ADIBE (Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.354e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVPISG+ GDNM+E ST + W+K            G  L++ALD I  P RP+DK LRLPLQDVYKIGGIGTVPVGRVETG+LKPG  V F P+ +TTEV
Sbjct:   26 EKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKMPWFKGWNVERKEGKAEGKCLIEALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGTIVVFAPANITTEV 275          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A3_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-3 PE=3 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 2.309e-100
Identity = 183/250 (73.20%), Postives = 206/250 (82.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S+ RY+EIVKEVS ++KK+G+NP+ VPFVPISG+ GDNM++ STN+ W+K            G TLL+A+D I  P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +K GM V F P+ +TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSQDRYNEIVKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLDESTNMPWFKGWNKETKAGSKTGKTLLEAIDAIEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKAGMVVNFAPAAVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_EUPCR (Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 2.309e-100
Identity = 179/237 (75.53%), Postives = 200/237 (84.39%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTE 711
            E+FEKE+AEM K SFKYAWVLDKLKAERERGITIDIALWKFET   + T+IDAPGHRDFIKNMITGTSQAD A+LII S TG FEAGISK+GQTREHALLA+T+GVKQM+   NKMD+T P YS+ RY+EI KEVS++L KVGY P K+ FVPISGF+GDN+ E STN+ WYKGPTL  ALD+   PKRP  KPLRLPLQDVYKIGGIGTVPVGRVETGVLK GM +TF P G + E
Sbjct:   40 EKFEKESAEMGKASFKYAWVLDKLKAERERGITIDIALWKFETENRHYTIIDAPGHRDFIKNMITGTSQADAAILIIASGTGEFEAGISKEGQTREHALLAYTMGVKQMVVAMNKMDSTEPPYSEDRYEEIKKEVSTFLAKVGYKPAKMNFVPISGFQGDNIQENSTNMPWYKGPTLCAALDSFKIPKRPIAKPLRLPLQDVYKIGGIGTVPVGRVETGVLKAGMVITFAPKGCSAE 276          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PORYE (Elongation factor 1-alpha OS=Porphyra yezoensis PE=2 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 3.016e-100
Identity = 181/242 (74.79%), Postives = 202/242 (83.47%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNL----DWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALWKFET KY  T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAGIS++GQTREHALLA+TLGVKQMI  CNKMD     +S+ RY+E+ KE+  YLKKVGYNP KVP VP SG+ G+N+ ER+        WYKGP LL+ALDN + PKRP DKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM VTF PSGL+TEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYSFTIIDAPGHRDFIKNMITGTSQADLAILVIASPPGEFEAGISQNGQTREHALLAYTLGVKQMIVACNKMDDKNVNWSQDRYEEVSKEMDLYLKKVGYNPAKVPKVPTSGWTGENLFERTDKTHALGKWYKGPCLLEALDNCDPPKRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGLIKPGMVVTFAPSGLSTEV 281          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_PUCGR (Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2)

HSP 1 Score: 363.999 bits (933), Expect = 5.145e-100
Identity = 184/250 (73.60%), Postives = 207/250 (82.80%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S+ R+ EIVKE S+++KKVGYNP+ + FVPISG+ GDNM+E STN+ W+            KG TLLDA+D I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETG +K GM VTF P+ +TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSEQRF-EIVKETSNFVKKVGYNPKSIAFVPISGWHGDNMLEESTNMGWFKGWTKETKAGVSKGKTLLDAIDAIEPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKAGMVVTFAPANVTTEV 286          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1AC_PORPU (Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 8.775e-100
Identity = 182/242 (75.21%), Postives = 201/242 (83.06%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTN----LDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAEM K SFKYAWVLDKLKAERERGITIDIALWKFET KY  T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAGIS++GQTREHALLA+TLGVKQMI  CNKMD     +SK RY+E+ KE+  YLKKVGYNP KVP VP SG+ G+N+ ER+        WYKGP LL+ALD  + PKRP DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM VTF PSGL+TEV
Sbjct:   40 EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETDKYNFTIIDAPGHRDFIKNMITGTSQADLAILVIASPPGEFEAGISQNGQTREHALLAYTLGVKQMIVACNKMDDKNVNWSKERYEEVSKEMDLYLKKVGYNPPKVPKVPTSGWTGENLFERTGGDHALGKWYKGPCLLEALDACDPPKRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPSGLSTEV 281          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A2_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-2 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 8.775e-100
Identity = 182/250 (72.80%), Postives = 205/250 (82.00%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLG +Q+I   NKMD T  K+S+ RY+EIVKEVS ++KK+G+NP+ VPFVPISG+ GDNM++ STN+ W+K            G TLL+A+D I  P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +K GM V F P+ +TTEV
Sbjct:   40 EKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGFRQLIVAINKMDTT--KWSQDRYNEIVKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLDESTNMPWFKGWNKETKAGSKTGKTLLEAIDAIEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKAGMVVNFAPAAVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A_CRYNE (Elongation factor 1-alpha OS=Cryptococcus neoformans GN=TEF1 PE=2 SV=2)

HSP 1 Score: 362.844 bits (930), Expect = 1.146e-99
Identity = 181/250 (72.40%), Postives = 206/250 (82.40%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWY------------KGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E+FEKEA E+ K SFKYAWVLDKLKAERERGITIDIALWKFET +Y  TVIDAPGHRDFIKNMITGTSQADCA+LII +  G FEAGISKDGQTREHALLAFTLGV+Q+I  CNKMD  T K+S+ R++EIVKE + ++KKVGYNP+ VPFVPISG+ GDNM+E +TN+ WY            KG TLL+A+D I  P RP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+K GM V F P+ +TTEV
Sbjct:   40 EKFEKEAQELGKSSFKYAWVLDKLKAERERGITIDIALWKFETPRYQVTVIDAPGHRDFIKNMITGTSQADCAILIIATGIGEFEAGISKDGQTREHALLAFTLGVRQLIVACNKMD--TCKWSEDRFNEIVKETNGFIKKVGYNPKAVPFVPISGWHGDNMLEETTNMPWYKGWTKETKSGVSKGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKAGMVVKFAPTNVTTEV 287          
BLAST of DC900195 vs. ExPASy Swiss-Prot
Match: EF1A1_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-1 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.497e-99
Identity = 182/250 (72.80%), Postives = 204/250 (81.60%), Query Frame = 1
Query:    1 ERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYK------------GPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMXVTFGPSGLTTEV 714
            E FEKEAAE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLG +Q+I   NKMD T  K+S+ RY+EIVKEVS ++KK+G+NP+ VPFVPISG+ GDNM++ STN+ W+K            G TLL+A+D I  P RPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +K GM V F P+ +TTEV
Sbjct:   40 EEFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGFRQLIVAINKMDTT--KWSQDRYNEIVKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLDESTNMPWFKGWNKETKAGSKTGKTLLEAIDAIEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKAGMVVNFAPAAVTTEV 287          
The following BLAST results are available for this feature:
BLAST of DC900195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ANIIF1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Anicla inf... [more]
EF1A_ADIBE1.354e-10072.80Elongation factor 1-alpha (Fragment) OS=Adisura be... [more]
EF1A3_RHIRA2.309e-10073.20Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]
EF1A1_EUPCR2.309e-10075.53Elongation factor 1-alpha 1 OS=Euplotes crassus GN... [more]
EF1A_PORYE3.016e-10074.79Elongation factor 1-alpha OS=Porphyra yezoensis PE... [more]
EF1A_PUCGR5.145e-10073.60Elongation factor 1-alpha OS=Puccinia graminis GN=... [more]
EF1AC_PORPU8.775e-10075.21Elongation factor 1-alpha C OS=Porphyra purpurea G... [more]
EF1A2_RHIRA8.775e-10072.80Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]
EF1A_CRYNE1.146e-9972.40Elongation factor 1-alpha OS=Cryptococcus neoforma... [more]
EF1A1_RHIRA1.497e-9972.80Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900195 VSS Citrus sinensis cDNA clone VS28233 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900195 ID=DC900195|Name=DC900195|organism=Citrus sinensis|type=EST|length=770bp
GAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTTGACTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATA
TCAATGAGCCAAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAG
GACGTGTACAAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGA
GACCGGTGTCCTCAAGCCTGGTATGGNGGTGACATTTGGCCCCTCTGGAT
TGACAACTGAGGTAAGTCTGTTGAGATGCACCACGAGCTNTGCAGGAGGC
CTTCCGGTGACATGTTGGCT
back to top