DC900189

Overview
NameDC900189
Unique NameDC900189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:1..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLT2A_ORYSJ (Non-specific lipid-transfer protein 2A OS=Oryza sativa subsp. japonica GN=LTP2-A PE=3 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 2.587e-20
Identity = 44/93 (47.31%), Postives = 59/93 (63.44%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            AAI+CGQV+S ++PCL+Y  G   PS ACC+GV  L     TTADR+ AC C+K+ A    G+    A  +P +CGV I   I+P IDCS ++
Sbjct:   26 AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 118          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.379e-20
Identity = 51/91 (56.04%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AITCGQV S LAPCLAYL   G P   CC GV+ L ++  TT DRQ AC C+K AA    GI L KA  LP  CGV+I   I+P  DCSK+
Sbjct:   24 AITCGQVTSNLAPCLAYLRNTG-PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_MAIZE (Non-specific lipid-transfer protein OS=Zea mays PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 9.832e-20
Identity = 44/95 (46.32%), Postives = 62/95 (65.26%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGK-PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            +AAI+CGQV S +APC++Y  G+G  PS  CC+GV  L +   TTADR+AAC C+K+AA    G+    A  +P +CGV I   I+   DCS+++
Sbjct:   26 EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLPN (Non-specific lipid-transfer protein 2 OS=Solanum pennellii GN=LTP2 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.284e-19
Identity = 47/91 (51.65%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            A+TCGQV S LAPCL YL   G P   CC GV+ L     TT DRQ AC C+K AA+ + G+ L KA  LP  C V+I   I+P  DCSK+
Sbjct:   24 ALTCGQVTSTLAPCLPYLMNRG-PLGGCCGGVKGLLGQAQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_BETVU (Non-specific lipid-transfer protein OS=Beta vulgaris GN=IWF1' PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.677e-19
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AITCG V S LAPC+ YL G   PS ACC G++ L     + ADR+ AC C+K AAT  +GI   KA  LP++CGV +   I+P+ +C+ I
Sbjct:   26 AITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAI 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLT41_HORVU (Non-specific lipid-transfer protein 4.1 OS=Hordeum vulgare GN=LTP4.1 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.190e-19
Identity = 48/93 (51.61%), Postives = 61/93 (65.59%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEG-KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AAI+CGQV S L+PC++Y  G G KP  ACC+GV+ L     +TAD+QAACKCIK AA    G+   KA  +P  CGV +   I+  +DCSKI
Sbjct:   25 AAISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAA---GGLNAGKAAGIPSMCGVSVPYAISASVDCSKI 114          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLCI (Non-specific lipid-transfer protein 2 OS=Solanum chilense PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.861e-19
Identity = 47/91 (51.65%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            A+TCGQV S LAPCL YL   G P   CC GV+ L     TT DRQAAC C+K AA+ +  + L KA  LP  C V+I   I+P  DCSK+
Sbjct:   24 ALTCGQVTSTLAPCLPYLMNRG-PLGGCCGGVKGLLGQAQTTVDRQAACACLKSAASSFTDLDLGKAASLPSTCNVNIPYKISPSTDCSKV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_GERHY (Non-specific lipid-transfer protein OS=Gerbera hybrida PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.736e-19
Identity = 46/91 (50.55%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AI+CGQV S L PC  YL   G    ACC GV  L +   TT DRQ AC C+K        I L+ A  LP +CG+ IG  ITP+IDCSKI
Sbjct:   25 AISCGQVTSGLVPCFGYLAAGGPVPPACCNGVRGLNNAAKTTPDRQTACGCLKGILAANTRINLNNANSLPGKCGISIGYKITPNIDCSKI 115          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLT43_HORVU (Non-specific lipid-transfer protein 4.3 OS=Hordeum vulgare GN=LTP4.3 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.736e-19
Identity = 48/93 (51.61%), Postives = 61/93 (65.59%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEG-KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AAI+CGQV S L+PC++Y  G G KP  ACC+GV+ L     +TAD+QAACKCIK AA    G+   KA  +P  CGV +   I+  +DCSKI
Sbjct:   25 AAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAA---GGLNAGKAAGIPSMCGVSVPYAISASVDCSKI 114          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLT42_HORVU (Non-specific lipid-transfer protein 4.2 OS=Hordeum vulgare GN=LTP4.2 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.736e-19
Identity = 48/93 (51.61%), Postives = 61/93 (65.59%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEG-KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AAI+CGQV S L+PC++Y  G G KP  ACC+GV+ L     +TAD+QAACKCIK AA    G+   KA  +P  CGV +   I+  +DCSKI
Sbjct:   25 AAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAA---GGLNAGKAAGIPSMCGVSVPYAISASVDCSKI 114          
The following BLAST results are available for this feature:
BLAST of DC900189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLT2A_ORYSJ2.587e-2047.31Non-specific lipid-transfer protein 2A OS=Oryza sa... [more]
NLTP1_TOBAC3.379e-2056.04Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLTP_MAIZE9.832e-2046.32Non-specific lipid-transfer protein OS=Zea mays PE... [more]
NLTP2_SOLPN1.284e-1951.65Non-specific lipid-transfer protein 2 OS=Solanum p... [more]
NLTP_BETVU1.677e-1948.35Non-specific lipid-transfer protein OS=Beta vulgar... [more]
NLT41_HORVU2.190e-1951.61Non-specific lipid-transfer protein 4.1 OS=Hordeum... [more]
NLTP2_SOLCI2.861e-1951.65Non-specific lipid-transfer protein 2 OS=Solanum c... [more]
NLTP_GERHY3.736e-1950.55Non-specific lipid-transfer protein OS=Gerbera hyb... [more]
NLT43_HORVU3.736e-1951.61Non-specific lipid-transfer protein 4.3 OS=Hordeum... [more]
NLT42_HORVU3.736e-1951.61Non-specific lipid-transfer protein 4.2 OS=Hordeum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900189 VSS Citrus sinensis cDNA clone VS28225 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900189 ID=DC900189|Name=DC900189|organism=Citrus sinensis|type=EST|length=605bp
AAAAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAA
AGCCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGG
AGCGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCT
CCTTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTG
CACTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGC
AAGCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATC
AAGCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGG
CGTTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCC
CACGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAG
AAAACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTAT
GCTGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTT
AGTGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATT
ACCTC
back to top