DC900189

Overview
NameDC900189
Unique NameDC900189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:1..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.880e-19
Identity = 44/91 (48.35%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            A++CGQV S LAPC++YLT  G    ACC+GV+ L     TT DRQAAC C+K A     G+    A   P +CGV I   I+P  DCSK+
Sbjct:   25 ALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKV 115          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_SORBI (Non-specific lipid-transfer protein 1 OS=Sorghum bicolor GN=LTP1 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.373e-19
Identity = 44/95 (46.32%), Postives = 60/95 (63.16%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEG-KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            +AAI+CGQV S +A CL+Y  G+G  PS  CC+GV  L     TTADR+AAC C+K+AA    G+    A  +P +CGV +   I+   DCS++S
Sbjct:   24 EAAISCGQVSSAIALCLSYARGQGFAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVS 118          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLLC (Non-specific lipid-transfer protein 1 OS=Solanum lycopersicum GN=TSW12 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 8.323e-19
Identity = 46/91 (50.55%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            A+TCGQV + LAPCL YL G G P   CC GV+ L  +  TTADR+ AC C+K AA   +GI L+KA  +P  C V+I   I+P  DCS +
Sbjct:   24 ALTCGQVTAGLAPCLPYLQGRG-PLGGCCGGVKNLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLPN (Non-specific lipid-transfer protein 1 OS=Solanum pennellii GN=LTP1 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.087e-18
Identity = 46/91 (50.55%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            A+TCGQV + LAPCL YL G G P   CC GV+ L  +  TTADR+ AC C+K AA   +GI L+KA  +P  C V+I   I+P  DCS +
Sbjct:   24 ALTCGQVTAGLAPCLPYLQGRG-PLGGCCGGVKGLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.422e-18
Identity = 43/90 (47.78%), Postives = 53/90 (58.89%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            ITCGQV S LAPC+ YL   G     CC GV  L +   TTADRQAAC C+K A    +G+ L+ A  LP +CGV +   I+P  DC  +
Sbjct:    1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSV 90          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP2_TOBAC (Non-specific lipid-transfer protein 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.163e-18
Identity = 45/91 (49.45%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            A++CGQV S LAPCL YL G G P  +CC GV+ L     + +DR+ AC C+K AA   +GI + KA  LP  CGV+I   I+P  DCSK+
Sbjct:   24 ALSCGQVQSGLAPCLPYLQGRG-PLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_HORVU (Non-specific lipid-transfer protein 1 OS=Hordeum vulgare GN=LTP1 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.163e-18
Identity = 40/95 (42.11%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  103 RGQAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            R   A+ CGQVDS + PCL Y+ G   PS  CC GV  L +   ++ DRQ  C C+K  A     + L+ A  +P +C V++   I+PDIDCS+I
Sbjct:   22 RAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.395e-18
Identity = 39/91 (42.86%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            A+TCGQV S LAPC+AY+ G G    ACC G+  + +   TTADRQ AC C+K  +    G+  + A  LP +CGV++   I+P  +C+ +
Sbjct:   26 ALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP4_ORYSJ (Non-specific lipid-transfer protein 4 OS=Oryza sativa subsp. japonica GN=Os12g0114500 PE=3 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 9.203e-18
Identity = 41/93 (44.09%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGE-GKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +A+TCGQV S LAPC+ Y TG    P+  CC GV  L     TTADRQ  C C+K   +   G++ D    +P +CGV+I   I+P  DCS++
Sbjct:   26 SAVTCGQVVSMLAPCIMYATGRVSAPTGGCCDGVRTLNSAAATTADRQTTCACLKQQTSAMGGLRPDLVAGIPSKCGVNIPYAISPSTDCSRV 118          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_HELAN (Non-specific lipid-transfer protein AP10 OS=Helianthus annuus PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 9.203e-18
Identity = 42/91 (46.15%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AITC  V   L PCL YL   GKP+ ACC G + L   T T ADR+ ACKC K AA + + ++ D A  LP +CG+   +PI P+++C+ I
Sbjct:   26 AITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115          
The following BLAST results are available for this feature:
BLAST of DC900189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTP_HELAN4.880e-1948.35Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP1_SORBI6.373e-1946.32Non-specific lipid-transfer protein 1 OS=Sorghum b... [more]
NLTP1_SOLLC8.323e-1950.55Non-specific lipid-transfer protein 1 OS=Solanum l... [more]
NLTP1_SOLPN1.087e-1850.55Non-specific lipid-transfer protein 1 OS=Solanum p... [more]
LTP1_MORNI2.422e-1847.78Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP2_TOBAC3.163e-1849.45Non-specific lipid-transfer protein 2 OS=Nicotiana... [more]
NLTP1_HORVU3.163e-1842.11Non-specific lipid-transfer protein 1 OS=Hordeum v... [more]
NLTP_PRUAV5.395e-1842.86Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP4_ORYSJ9.203e-1844.09Non-specific lipid-transfer protein 4 OS=Oryza sat... [more]
NLTP1_HELAN9.203e-1846.15Non-specific lipid-transfer protein AP10 OS=Helian... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900189 VSS Citrus sinensis cDNA clone VS28225 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900189 ID=DC900189|Name=DC900189|organism=Citrus sinensis|type=EST|length=605bp
AAAAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAA
AGCCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGG
AGCGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCT
CCTTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTG
CACTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGC
AAGCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATC
AAGCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGG
CGTTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCC
CACGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAG
AAAACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTAT
GCTGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTT
AGTGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATT
ACCTC
back to top