DC900189

Overview
NameDC900189
Unique NameDC900189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:1..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_WHEAT (Non-specific lipid-transfer protein (Fragment) OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.202e-17
Identity = 40/95 (42.11%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  103 RGQAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            R   AI CG VDS + PCL+Y+ G   PS  CC GV+ L +   + +DRQ+AC C+K  A     +  D AR +P +CGV++   I+ +IDCS++
Sbjct:   19 RAAVAIDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP8_HORVU (Non-specific lipid-transfer protein Cw18 OS=Hordeum vulgare GN=CW18 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.678e-17
Identity = 44/93 (47.31%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEG-KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AAITCGQV S L PC AY  G G  PS  CC+GV+ L     +TAD+QA C+C+K  A  Y      +A  +P  CGV +   I+  +DCSKI
Sbjct:   25 AAITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGAYNA---GRAAGIPSRCGVSVPYTISASVDCSKI 114          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.678e-17
Identity = 40/91 (43.96%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AITCGQV S LAPC+ Y+ G G    ACC G+  + +   TT DRQAAC C+K  +    G+  + A  LP +CGV+I   I+P  +C+ +
Sbjct:   26 AITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANV 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTPB_RICCO (Non-specific lipid-transfer protein B OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.497e-17
Identity = 42/92 (45.65%), Postives = 58/92 (63.04%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTG-EGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            + CGQV+  L+ C+ +LTG +  PS  CC GV  LK   PT  D++ AC+C+K AA RY  I+ D A  LP +CGV I VPI+   +C +I+
Sbjct:    1 VNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYPNIREDAASSLPYKCGVVINVPISKTTNCHEIN 92          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP3_LENCU (Non-specific lipid-transfer protein 3 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.497e-17
Identity = 42/93 (45.16%), Postives = 56/93 (60.22%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +AA++CG V   LAPC+ YLTG   P+ +CC GV+ L    PTTADRQAAC C+K AA     +    A  LP +C V+I   I+   +C+ I
Sbjct:   24 EAAVSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTAAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTI 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_ELECO (Non-specific lipid-transfer protein OS=Eleusine coracana PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.567e-17
Identity = 45/94 (47.87%), Postives = 59/94 (62.77%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGK-PSRACCTGVEYLKDNTPTTADRQAACKC-IKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            AI+CGQV S + PCLAY  G G  PS +C +GV  L     TTADR+AAC C +K AA+R  G+   KA  +P  CGV +   I+  IDCS+++
Sbjct:    1 AISCGQVSSAIGPCLAYARGAGAAPSASCQSGVRSLNAAARTTADRRAACNCSLKSAASRVSGLNAGKASSIPGRCGVRLPYAISASIDCSRVN 94          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP2_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.965e-17
Identity = 44/95 (46.32%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPS--RACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            Q A+T GQV + LAPC+ YL G G  +    CCTG++ L     TT  RQAAC+CIK AA    GI    A  LP +CGV+I   I+P  DC+ +
Sbjct:   25 QGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV 119          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.965e-17
Identity = 44/95 (46.32%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPS--RACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            Q A+T GQV + LAPC+ YL G G  +    CCTG++ L     TT  RQAAC+CIK AA    GI    A  LP +CGV+I   I+P  DC+ +
Sbjct:   21 QGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV 115          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_CICAR (Non-specific lipid-transfer protein OS=Cicer arietinum PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.017e-16
Identity = 43/93 (46.24%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            ++AITCG+VD+ LAPCL YL G   PS  CC GV  L     TT DRQAAC C+K AA     +  + A  LP +C V+I   I+   +C+ I
Sbjct:   22 ESAITCGRVDTALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCVVNIPYKISTSTNCATI 114          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP6_LENCU (Non-specific lipid-transfer protein 6 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.017e-16
Identity = 43/93 (46.24%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            + AI+CG V S L+PCL YLTG   PS  CC GV+ L     TT DRQAAC C+K AA     +  + A  LP +CGVDI   I+   +C+ +
Sbjct:   24 EGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVDIPYKISTSTNCNTV 116          
The following BLAST results are available for this feature:
BLAST of DC900189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTP1_WHEAT1.202e-1742.11Non-specific lipid-transfer protein (Fragment) OS=... [more]
NLTP8_HORVU2.678e-1747.31Non-specific lipid-transfer protein Cw18 OS=Hordeu... [more]
NLTP1_PRUDU2.678e-1743.96Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTPB_RICCO3.497e-1745.65Non-specific lipid-transfer protein B OS=Ricinus c... [more]
NLTP3_LENCU3.497e-1745.16Non-specific lipid-transfer protein 3 OS=Lens culi... [more]
NLTP_ELECO4.567e-1747.87Non-specific lipid-transfer protein OS=Eleusine co... [more]
NLTP2_GOSHI5.965e-1746.32Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP1_GOSHI5.965e-1746.32Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP_CICAR1.017e-1646.24Non-specific lipid-transfer protein OS=Cicer ariet... [more]
NLTP6_LENCU1.017e-1646.24Non-specific lipid-transfer protein 6 OS=Lens culi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900189 VSS Citrus sinensis cDNA clone VS28225 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900189 ID=DC900189|Name=DC900189|organism=Citrus sinensis|type=EST|length=605bp
AAAAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAA
AGCCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGG
AGCGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCT
CCTTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTG
CACTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGC
AAGCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATC
AAGCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGG
CGTTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCC
CACGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAG
AAAACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTAT
GCTGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTT
AGTGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATT
ACCTC
back to top