DC900189

Overview
NameDC900189
Unique NameDC900189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:1..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP2_BRANA (Non-specific lipid-transfer protein 2 OS=Brassica napus GN=LTP2 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.017e-16
Identity = 39/92 (42.39%), Postives = 55/92 (59.78%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AA++CG V  ++APC+ YLT  G   R CCTGV  L +   TT DRQ AC+C+  AA  +  +   +A  LPK CGV+I   I+   +C+ +
Sbjct:   25 AALSCGTVSGYVAPCIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSV 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_PINTA (Non-specific lipid-transfer protein OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.267e-16
Identity = 43/95 (45.26%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGK-PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGV-DIGVPITPDIDCSKI 387
            + AI+C QV S + PC  YL G    P+  CC  +  L      T DRQA C C+K  A  Y G+KL KA  LP  C V D+ VPI+P++DCSK+
Sbjct:   29 EGAISCNQVVSAMTPCATYLIGNAATPAATCCPSIRGLDSQVKATPDRQAVCNCLKTQAKSY-GVKLGKAANLPGLCKVTDLNVPISPNVDCSKV 122          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLLC (Non-specific lipid-transfer protein 2 OS=Solanum lycopersicum GN=LE16 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.267e-16
Identity = 43/91 (47.25%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +++CG+V S LAPCL YL G G P   CC GV+ L     T  DR+ AC C+K AA   +GI   KA  LP  CGV+I   I+P  DCS +
Sbjct:   24 SLSCGEVTSGLAPCLPYLEGRG-PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 2.960e-16
Identity = 42/93 (45.16%), Postives = 53/93 (56.99%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +A ITCG V S LAPC+ YL G G     CC G++ L     TT DR+ AC C+K AA   +GI   KA  LP  CGV I   I+P  +C+ +
Sbjct:   25 EAGITCGMVSSKLAPCIGYLKG-GPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP4_LENCU (Non-specific lipid-transfer protein 4 (Fragment) OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.866e-16
Identity = 42/93 (45.16%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            + AI+CG V S L+PCL YLTG   PS  CC GV+ L     TT DRQAAC C+K AA     +  + A  LP +CGV+I   I+   +C+ +
Sbjct:   16 EGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTV 108          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP2_LENCU (Non-specific lipid-transfer protein 2 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.050e-16
Identity = 42/93 (45.16%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            + AI+CG V S L+PCL YLTG   PS  CC GV+ L     TT DRQAAC C+K AA     +  + A  LP +CGV+I   I+   +C+ +
Sbjct:   24 EGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP5_LENCU (Non-specific lipid-transfer protein 5 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.595e-16
Identity = 41/93 (44.09%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            + AI+CG V   L+PCL YLTG   PS  CC GV+ L     TT DRQAAC C+K AA+    +  + A  LP +CGV+I   I+   +C+ +
Sbjct:   23 EGAISCGAVTGDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCMKSAASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTV 115          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.613e-16
Identity = 38/91 (41.76%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AITCGQV S LAPC+ Y+   G    ACC G+  +     TTADRQ AC C+K+ A    G+  + A  LP +CGV++   I+   +C+ +
Sbjct:   24 AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV 114          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.125e-15
Identity = 38/90 (42.22%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            ITCGQV S LAPC+ Y+ G G    ACC G+  + +   TT DRQAAC C+K  +    G+  + A  LP +CGV I   I+   +C+ +
Sbjct:    1 ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATV 90          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTPB_BRAOT (Non-specific lipid-transfer protein B OS=Brassica oleracea var. italica GN=WAX9B PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.919e-15
Identity = 39/92 (42.39%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AA++CG V   LA C+ YLT  G   R CCTGV  L +   TT DRQ AC+C+  AA  +  +   +A  LPK CGV+I   I+   +C+ +
Sbjct:   25 AALSCGTVSGNLAACIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSV 116          
The following BLAST results are available for this feature:
BLAST of DC900189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTP2_BRANA1.017e-1642.39Non-specific lipid-transfer protein 2 OS=Brassica ... [more]
NLTP_PINTA2.267e-1645.26Non-specific lipid-transfer protein OS=Pinus taeda... [more]
NLTP2_SOLLC2.267e-1647.25Non-specific lipid-transfer protein 2 OS=Solanum l... [more]
NLTP_SPIOL2.960e-1645.16Non-specific lipid-transfer protein OS=Spinacia ol... [more]
NLTP4_LENCU3.866e-1645.16Non-specific lipid-transfer protein 4 (Fragment) O... [more]
NLTP2_LENCU5.050e-1645.16Non-specific lipid-transfer protein 2 OS=Lens culi... [more]
NLTP5_LENCU6.595e-1644.09Non-specific lipid-transfer protein 5 OS=Lens culi... [more]
NLTP_MALDO8.613e-1641.76Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_PRUPE1.125e-1542.22Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTPB_BRAOT1.919e-1542.39Non-specific lipid-transfer protein B OS=Brassica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900189 VSS Citrus sinensis cDNA clone VS28225 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900189 ID=DC900189|Name=DC900189|organism=Citrus sinensis|type=EST|length=605bp
AAAAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAA
AGCCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGG
AGCGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCT
CCTTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTG
CACTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGC
AAGCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATC
AAGCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGG
CGTTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCC
CACGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAG
AAAACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTAT
GCTGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTT
AGTGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATT
ACCTC
back to top