DC900189

Overview
NameDC900189
Unique NameDC900189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:1..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP5_VITSX (Non-specific lipid-transfer protein P5 OS=Vitis sp. PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.919e-15
Identity = 37/91 (40.66%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            ++CG V + LAPC+ YL   G    ACC GV+ LK++  TT DR+ ACKC+ +A+    G+    A  LP +CGV+I   I+P  +C +++
Sbjct:    1 LSCGDVATQLAPCINYLRSAGPLPVACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQVN 91          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.919e-15
Identity = 37/90 (41.11%), Postives = 54/90 (60.00%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            ITCGQV S LAPC+ Y+ G G    ACC G+  + +   TTADR+AAC C+K  +    G+  + A  LP +CGV++   I+   +C+ +
Sbjct:    1 ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATV 90          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_PHAAU (Non-specific lipid-transfer protein 1 OS=Phaseolus aureus PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.919e-15
Identity = 39/91 (42.86%), Postives = 57/91 (62.64%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            +TCGQV   LA C+ +L   G    +CCTGV+ + +++ TTADR+A C C+K AA   RGI  + A  LP +CGV+I   I+   +C+ I+
Sbjct:    1 MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSIN 91          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_BRANA (Non-specific lipid-transfer protein 1 OS=Brassica napus GN=LTP1 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.919e-15
Identity = 39/92 (42.39%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AA++CG V   LA C+ YLT  G   R CCTGV  L +   TT DRQ AC+C+  AA  +  +   +A  LPK CGV+I   I+   +C+ +
Sbjct:   25 AALSCGTVSGNLAACIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANAFPTLNAARAAGLPKACGVNIPYKISKSTNCNSV 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTPA_BRAOT (Non-specific lipid-transfer protein A OS=Brassica oleracea var. italica GN=WAX9A PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.273e-15
Identity = 41/93 (44.09%), Postives = 58/93 (62.37%), Query Frame = 1
Query:  115 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLD--KARQLPKECGVDIGVPITPDIDCSKI 387
            A+TCG V+S +APC+ Y+T  G    ACCTGV  L     TT DRQ AC+C++ AA R  G  L+  +A  +PK CGV +  PI+ + +C+ +
Sbjct:   26 ALTCGTVNSNVAPCIGYITQGGTLPGACCTGVSKLNSMARTTPDRQQACRCLETAA-RALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV 117          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_LENCU (Non-specific lipid-transfer protein 1 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.273e-15
Identity = 40/93 (43.01%), Postives = 52/93 (55.91%), Query Frame = 1
Query:  109 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            +AAI+CG V   L PCL YL G   PS  CC GV+ L     TT DR+AAC C+K +A    G+K      LP +CGV +   I+   +C+ I
Sbjct:   24 EAAISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTI 116          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP4_ARATH (Non-specific lipid-transfer protein 4 OS=Arabidopsis thaliana GN=LTP4 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.275e-15
Identity = 42/92 (45.65%), Postives = 54/92 (58.70%), Query Frame = 1
Query:  112 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            AAITCG V S L+PCL YL+  G     CC GV+ L     TT DRQ AC+C++ AA   +G+    A  LP +CGV I  PI+   +C+ I
Sbjct:   23 AAITCGTVASSLSPCLGYLSKGGVVPPPCCAGVKKLNGMAQTTPDRQQACRCLQSAA---KGVNPSLASGLPGKCGVSIPYPISTSTNCATI 111          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP3_VITSX (Non-specific lipid-transfer protein P3 OS=Vitis sp. PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.275e-15
Identity = 36/91 (39.56%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 390
            ++CG V + +A C+ YL G G    ACC GV+ LK++  TT DR+ ACKC+  A+    G+    A  LP +CGV I   I+P  +C +++
Sbjct:    1 LSCGDVATQMASCINYLRGAGPLPAACCNGVKNLKNSATTTQDRRTACKCLISASKTISGVNFGLAAGLPAKCGVSIPYKISPSTNCDQVN 91          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLT22_PARJU (Probable non-specific lipid-transfer protein 2 OS=Parietaria judaica PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.275e-15
Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  124 CGQVDSFLAPCLAYLTGEGK-PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGV-PITPDIDCSKI 387
            CG+V   + PCL ++ GE K PS++CC+G + L +   TT  ++ ACKCI  A     GIK +   ++PK+CG+   + PIT D DCSKI
Sbjct:   35 CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKI 124          
BLAST of DC900189 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 5.583e-15
Identity = 36/90 (40.00%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  118 ITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 387
            ITCGQV S LAPC+ Y+ G G    ACC G+  + +   TT DR+ AC C+K  +    G+  + A  LP +CGV+I   I+   +C+ +
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATV 90          
The following BLAST results are available for this feature:
BLAST of DC900189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTP5_VITSX1.919e-1540.66Non-specific lipid-transfer protein P5 OS=Vitis sp... [more]
NLTP1_PRUDO1.919e-1541.11Non-specific lipid-transfer protein 1 OS=Prunus do... [more]
NLTP1_PHAAU1.919e-1542.86Non-specific lipid-transfer protein 1 OS=Phaseolus... [more]
NLTP1_BRANA1.919e-1542.39Non-specific lipid-transfer protein 1 OS=Brassica ... [more]
NLTPA_BRAOT3.273e-1544.09Non-specific lipid-transfer protein A OS=Brassica ... [more]
NLTP1_LENCU3.273e-1543.01Non-specific lipid-transfer protein 1 OS=Lens culi... [more]
NLTP4_ARATH4.275e-1545.65Non-specific lipid-transfer protein 4 OS=Arabidops... [more]
NLTP3_VITSX4.275e-1539.56Non-specific lipid-transfer protein P3 OS=Vitis sp... [more]
NLT22_PARJU4.275e-1543.33Probable non-specific lipid-transfer protein 2 OS=... [more]
NLTP1_PRUAR5.583e-1540.00Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900189 VSS Citrus sinensis cDNA clone VS28225 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900189 ID=DC900189|Name=DC900189|organism=Citrus sinensis|type=EST|length=605bp
AAAAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAA
AGCCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGG
AGCGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCT
CCTTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTG
CACTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGC
AAGCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATC
AAGCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGG
CGTTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCC
CACGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAG
AAAACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTAT
GCTGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTT
AGTGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATT
ACCTC
back to top