DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: GSP1_YARLI (GTP-binding nuclear protein GSP1/Ran OS=Yarrowia lipolytica GN=GSP1 PE=3 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 2.357e-84
Identity = 145/181 (80.11%), Postives = 161/181 (88.95%), Query Frame = 2
Query:   80 SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            +FKLV+VGDGGTGKTTFVKRH TGEF  +Y  T+GVEVHPL+F T+CG IRF  WDTAGQEKFGGLRDGYYI+GQC IIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+P+L FV +PAL P E  ID
Sbjct:    7 AFKLVLVGDGGTGKTTFVKRHETGEFVNRYNATLGVEVHPLNFATDCGNIRFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPSLEFVATPALRPAETAID 187          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RANT_RAT (GTP-binding nuclear protein Ran, testis-specific isoform OS=Rattus norvegicus GN=Rasl2-9 PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 9.903e-83
Identity = 144/182 (79.12%), Postives = 160/182 (87.91%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKLV+VGDGGTGKTTF+KRHLTGEFEK+Y  T+GVEVH L F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP+WH+DL RVCENIPIVLCGNKVD+K+ +VKAK + FHRKKNLQYY+ISAKSNYNFEKPF +LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKLVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDIKDMKVKAKPILFHRKKNLQYYDISAKSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN4_ARATH (GTP-binding nuclear protein Ran-4 OS=Arabidopsis thaliana GN=RAN4 PE=3 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.206e-82
Identity = 145/196 (73.98%), Postives = 166/196 (84.69%), Query Frame = 2
Query:   44 MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLAD 631
            MALP+QQ VD P+FKL+IVGDGGTGKTTF+KRHLTGEFE   EPT+GV+++PLDFFTN GKIRF CWDTAGQEK+ GL+D YYIHGQCAIIMFDVTAR TY N+  W+RDL RVC+NIPIVLCGNKVDV +RQ+K K V++HRKK LQYYE+SAK+N NFEKPFLYLAR++AGD  L FVES     PE QID  D
Sbjct:    1 MALPNQQNVDLPTFKLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFTNRGKIRFECWDTAGQEKYSGLKDAYYIHGQCAIIMFDVTARHTYMNIDRWYRDLRRVCKNIPIVLCGNKVDVPSRQIKPKHVSYHRKKCLQYYEMSAKNNCNFEKPFLYLARRIAGDAKLSFVES-----PEAQIDNLD 191          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RANT_MOUSE (GTP-binding nuclear protein Ran, testis-specific isoform OS=Mus musculus GN=Rasl2-9 PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.763e-82
Identity = 143/182 (78.57%), Postives = 160/182 (87.91%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FK+V+VGDGGTGKTTF+KRHLTGEFEK+Y  T+GVEVH L F TN G I+F  WDTAGQEKFGGLRDGYYI  QCAIIMFDVT+R+TYKNVP+WH+DL RVCENIPIVLCGNKVDVK+ +VKAK + FHRKKNLQYY+ISA+SNYNFEKPF +LARKL GDPNL FV  PALAPPEV +D A
Sbjct:   11 FKVVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDVKDMKVKAKPILFHRKKNLQYYDISARSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPA 192          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_PLAFA (GTP-binding nuclear protein Ran OS=Plasmodium falciparum PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 3.645e-77
Identity = 135/183 (73.77%), Postives = 157/183 (85.79%), Query Frame = 2
Query:   77 PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDL 625
            P +KL++VGDGG GKTTFVKRHLTGEFEKKY PT+GVEVHPL F TN GK +F  WDTAGQEKFGGLRDGYYI   CAIIMFDV++R+TYKNVP W+RD+ RVCE IP+VL GNKVDVK+RQVK++Q+ FHRK+NLQYY++SA+SNYNFEKPFL+LAR+L+  PNL FV   A A PE QIDL
Sbjct:    8 PQYKLILVGDGGVGKTTFVKRHLTGEFEKKYIPTLGVEVHPLKFQTNFGKTQFNVWDTAGQEKFGGLRDGYYIKSDCAIIMFDVSSRITYKNVPNWYRDITRVCETIPMVLVGNKVDVKDRQVKSRQIQFHRKRNLQYYDLSARSNYNFEKPFLWLARRLSNQPNLVFVGEHAKA-PEFQIDL 189          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_DICDI (GTP-binding nuclear protein Ran OS=Dictyostelium discoideum GN=ranA PE=1 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 6.434e-74
Identity = 127/179 (70.95%), Postives = 147/179 (82.12%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 622
            KLV+VGDGG GKTTFV+RHLTGEFE +Y PT+GV VHPL F+TN GKI F  WDTAGQEKFGGLRDGYYI G CAIIMFDVT+R++YKNVP WH DL RVCENIPIVLCGNKVDVK+R+VK  Q+ FHR+ NL YY++SAKSNYNFEKPF++L  KL G+  +  V+ P L  PE  +D
Sbjct:    8 KLVLVGDGGVGKTTFVQRHLTGEFEPRYIPTLGVSVHPLIFYTNFGKIHFNVWDTAGQEKFGGLRDGYYIQGNCAIIMFDVTSRISYKNVPNWHSDLTRVCENIPIVLCGNKVDVKDRKVKPSQIVFHRRYNLSYYDVSAKSNYNFEKPFVWLTSKLLGNKAVTLVQQPTLKLPETVLD 186          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_TETTH (GTP-binding nuclear protein Ran OS=Tetrahymena thermophila PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.175e-67
Identity = 118/178 (66.29%), Postives = 143/178 (80.34%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQ 616
            FKLV+VGDGG GKTTFV RH TGEFEK+Y  T GV V  +  +T  G IRF  WDTAGQEK GGLR+GYYI    AI+MFDVT+R+TYKN+P WH+DL R+CENIPIVL GNKVD K+R+VKA+Q+TFHRK++LQYY++SAKSNY +EKPFL++ RKL GDP L+ VE  AL  P+ +
Sbjct:   12 FKLVLVGDGGVGKTTFVTRHQTGEFEKRYIATQGVNVSNMVLYTTKGPIRFNIWDTAGQEKLGGLREGYYIGANAAIMMFDVTSRITYKNIPKWHKDLTRICENIPIVLVGNKVDSKDRKVKARQITFHRKRSLQYYDVSAKSNYQYEKPFLWILRKLTGDPTLNLVEGIALVAPDTE 189          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_TETPY (GTP-binding nuclear protein Ran OS=Tetrahymena pyriformis PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.175e-67
Identity = 118/179 (65.92%), Postives = 144/179 (80.45%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQI 619
            FKLV+VGDGG GKTTFV RH TGEFEK+Y  T GV V  +   T  G IRF  WDTAGQEK GGLR+GYYI    AI+MFDVT+R+TYKN+P WH+DL R+CEN+PIVL GNKVD K+ +VKA+Q+TFHRK++LQYY++SAKSNY +EKPFL++ RKL GDPNL+ VE  ALAP ++ +
Sbjct:   12 FKLVLVGDGGVGKTTFVTRHQTGEFEKRYIATQGVNVSNMILHTTKGAIRFNIWDTAGQEKLGGLREGYYIGADAAIMMFDVTSRITYKNIPKWHKDLTRICENVPIVLVGNKVDSKDSKVKARQITFHRKRSLQYYDVSAKSNYQYEKPFLWILRKLTGDPNLNLVEGIALAPVDIHM 190          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RANL_DROME (GTP-binding nuclear protein Ran-like OS=Drosophila melanogaster GN=ran-like PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.030e-63
Identity = 113/177 (63.84%), Postives = 136/177 (76.84%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEV 613
            FKL+++GDGGTGKTT VKRHLTGEF+ +Y  T+GVEV  L F TN G  R   WDTAGQE++GGLRDGY++  QCAIIMFDV +  TY NV  WHRDL RVC NIPIV+CGNKVD+ +++   K V F RK N+   E+SAKSNYN EKPF+YL RKL GDP+L  V+SPA+ PP+V
Sbjct:   11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKV 187          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAN_GIALA (GTP-binding nuclear protein Ran OS=Giardia lamblia PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.300e-52
Identity = 99/200 (49.50%), Postives = 132/200 (66.00%), Query Frame = 2
Query:   80 SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFT------NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCEN-----------IPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            SFK+++VGDG TGKTTFV RH+TGEF K+Y  TIGVE+  L F+       N  ++     DTAGQEKFGGLRDGYY+     ++ FDVT R+TYKNV +W+RD+ R+C             + IVL GNK DVK+R+++ + V FHR KN+ Y EISAK N+N+E P L + R L  DP + F ++PAL P ++ +D A
Sbjct:    6 SFKVILVGDGATGKTTFVTRHITGEFRKQYISTIGVEIRQLPFYVAGQSCPNGREVLLNVHDTAGQEKFGGLRDGYYVDSDACLLFFDVTNRVTYKNVESWYRDVFRICPTRRDASTGEEKPLAIVLVGNKCDVKDREIRTQTVKFHRSKNIPYVEISAKDNFNYELPILSILRTLLNDPTIQFSQAPALLPADIGMDAA 205          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSP1_YARLI2.357e-8480.11GTP-binding nuclear protein GSP1/Ran OS=Yarrowia l... [more]
RANT_RAT9.903e-8379.12GTP-binding nuclear protein Ran, testis-specific i... [more]
RAN4_ARATH2.206e-8273.98GTP-binding nuclear protein Ran-4 OS=Arabidopsis t... [more]
RANT_MOUSE3.763e-8278.57GTP-binding nuclear protein Ran, testis-specific i... [more]
RAN_PLAFA3.645e-7773.77GTP-binding nuclear protein Ran OS=Plasmodium falc... [more]
RAN_DICDI6.434e-7470.95GTP-binding nuclear protein Ran OS=Dictyostelium d... [more]
RAN_TETTH1.175e-6766.29GTP-binding nuclear protein Ran OS=Tetrahymena the... [more]
RAN_TETPY1.175e-6765.92GTP-binding nuclear protein Ran OS=Tetrahymena pyr... [more]
RANL_DROME1.030e-6363.84GTP-binding nuclear protein Ran-like OS=Drosophila... [more]
RAN_GIALA5.300e-5249.50GTP-binding nuclear protein Ran OS=Giardia lamblia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top