DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB19_MOUSE (Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=2 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 1.078e-20
Identity = 59/178 (33.15%), Postives = 98/178 (55.06%), Query Frame = 2
Query:   56 SQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRV-CENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAGDPNLH 577
            S + VDY  FK++++GD   GKT  V+   +G + +  + TIGV+        +  K++   WDTAGQE+F  +   YY     AII +D+T R T+++VP W  ++ +    N+ I+L GNK D+ + R V  +      +K+  L   E SAK + N ++ F+ +A++L    +LH
Sbjct:   10 SDENVDY-LFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLWEKRHVLFEDACTLAEKHGLLAVLETSAKESRNIDEVFVLMAKELIARNSLH 186          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB9A_CANFA (Ras-related protein Rab-9A OS=Canis familiaris GN=RAB9A PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.408e-20
Identity = 54/182 (29.67%), Postives = 95/182 (52.20%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-----CRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAG--DPNLHFVESPALA 601
            FK++++GDGG GK++ + R++T +F+ +   TIGVE    D   +   +    WDTAGQE+F  LR  +Y    C ++ F V    +++N+  W ++       +  E+ P V+ GNK+D+  RQV  ++     + N    Y+E SAK   N    F    R++    D + H +++  ++
Sbjct:    8 FKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVS 189          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB23_MOUSE (Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.408e-20
Identity = 51/164 (31.10%), Postives = 85/164 (51.83%), Query Frame = 2
Query:   80 SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVD------VKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARK 553
            + K+V+VG+G  GK++ ++R+  G F K Y+ TIGV+        N   +R   WDTAGQE+F  +   YY   Q  +++F  T R +++ + +W   +     +IP  L  NK+D      +KN + +       ++  L++Y  S K + N  + F YLA K
Sbjct:    9 AIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVGDIPTALVQNKIDLLDDSCIKNEEAEG----LAKRLKLRFYRTSVKEDLNVSEVFKYLAEK 168          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB10_CHICK (Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.408e-20
Identity = 54/161 (33.54%), Postives = 91/161 (56.52%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-RVCENIPIVLCGNKVDVKNRQV--KAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL 556
            FKL+++GD G GKT  + R     F   +  TIG+++          KI+   WDTAGQE+F  +   YY      ++++D+T   +++N+  W R++     E++  +L GNK D+++++V  KAK     R+  ++++E SAK+N N EK FL LA  +
Sbjct:   10 FKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDLKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDI 170          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB9A_HUMAN (Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.839e-20
Identity = 54/178 (30.34%), Postives = 93/178 (52.25%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-----CRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAG--DPNLHFVES 589
            FK++++GDGG GK++ + R++T +F+ +   TIGVE    D   +   +    WDTAGQE+F  LR  +Y    C ++ F V    +++N+  W ++       +  E+ P V+ GNK+D+  RQV  ++     + N    Y+E SAK   N    F    R++    D + H +++
Sbjct:    8 FKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQT 185          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB26_DROME (Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.839e-20
Identity = 58/173 (33.53%), Postives = 94/173 (54.34%), Query Frame = 2
Query:   53 PSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEK-KYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVC-ENIPIVLCGNKVDV--KNRQVKAKQ-VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL 556
            P   TV++   K +++GD G GKT+F+ ++ TGEF    +  T+G+ +       +  +++   WDTAGQE+F  +   YY      ++++DVT + TY N+  W  ++     E++ IVL GNK D     RQVK +      R+ N+ + E SAK+  N E  F  +AR+L
Sbjct:  184 PFDDTVNH---KTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQL 353          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7_SOYBN (Ras-related protein Rab7 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.401e-20
Identity = 53/188 (28.19%), Postives = 96/188 (51.06%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVC-----ENIPIVLCGNKVDV---KNRQVKAKQVT--FHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG---DPNLHFVESPALAPPE 610
            K++++GD G GKT+ + +++  +F ++Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C ++++DV    ++  +  WH +  +          P +L GNK+D+    +R V  K+       K N+ Y+E SAK +YN +  FL +A+       + +++F   P  A PE
Sbjct:   10 KVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPRAFPFILLGNKIDIDGGNSRVVSEKKAKDWCAAKGNIPYFETSAKEDYNVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPE 197          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB19_HUMAN (Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 2.401e-20
Identity = 60/188 (31.91%), Postives = 99/188 (52.66%), Query Frame = 2
Query:   47 ALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRV-CENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPAL 598
            A  + +  DY  FK++++GD   GKT  V+   +G + +  + TIGV+        +  K++   WDTAGQE+F  +   YY     AII +D+T R T++++P W  ++ +    N+ I+L GNK D+ + R V  +      +K   L   E SAK + N E+ F+ +A++L    +LH     AL
Sbjct:    7 ARAADENFDY-LFKIILIGDSNVGKTCVVQHFKSGVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESIPHWIHEIEKYGAANVVIMLIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKESKNIEEVFVLMAKELIARNSLHLYGESAL 193          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB2B_DICDI (Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.136e-20
Identity = 61/172 (35.47%), Postives = 92/172 (53.49%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCE--NIPIVLCGNKVDVK-NRQVKAKQV-TFHRKKNLQYYEISAKSNYN----FEKPFLYLARKLAGDPNL 574
            FK ++VGD   GK+  + + +   F    + TIGVE        N  +I+   WDTAGQEKF  +   YY    CA+I++D+T R +++++ +W  D CR     ++  VL GNK D++ NRQV   +   F  K  L ++E SAK+  N    FEK    + +KL  +P L
Sbjct:   25 FKYIMVGDSAVGKSNLLLQFVDKRFAPNSDFTIGVEFGSRSININDKQIKLQIWDTAGQEKFRSITRAYYRGAVCAMIVYDITRRDSFESLNSWLTD-CRKFSSCDVTTVLIGNKADLEANRQVSTSEAKEFAEKNGLMFFETSAKTALNVDEAFEKSTEQILKKLESNPGL 195          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB5B_PONAB (Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.096e-20
Identity = 58/161 (36.02%), Postives = 89/161 (55.28%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDVKN-RQVKAKQVTFHRKKN-LQYYEISAKSNYNFEKPFLYLARKL 556
            FKLV++G+   GK++ V R + G+F +  E TIG          +   ++F  WDTAGQE++  L   YY   Q AI+++D+T + T+    TW ++L R    +I I L GNK D+ N R V+ ++   +   N L + E SAK+  N    FL +A+KL
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKL 181          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAB19_MOUSE1.078e-2033.15Ras-related protein Rab-19 OS=Mus musculus GN=Rab1... [more]
RAB9A_CANFA1.408e-2029.67Ras-related protein Rab-9A OS=Canis familiaris GN=... [more]
RAB23_MOUSE1.408e-2031.10Ras-related protein Rab-23 OS=Mus musculus GN=Rab2... [more]
RAB10_CHICK1.408e-2033.54Ras-related protein Rab-10 OS=Gallus gallus GN=RAB... [more]
RAB9A_HUMAN1.839e-2030.34Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9... [more]
RAB26_DROME1.839e-2033.53Ras-related protein Rab-26 OS=Drosophila melanogas... [more]
RAB7_SOYBN2.401e-2028.19Ras-related protein Rab7 OS=Glycine max PE=2 SV=1[more]
RAB19_HUMAN2.401e-2031.91Ras-related protein Rab-19 OS=Homo sapiens GN=RAB1... [more]
RAB2B_DICDI3.136e-2035.47Ras-related protein Rab-2B OS=Dictyostelium discoi... [more]
RAB5B_PONAB4.096e-2036.02Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top