DC900183

Overview
NameDC900183
Unique NameDC900183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length672
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8429 contig Csv1_Contig8429:927..1598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB5B_MOUSE (Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.096e-20
Identity = 58/161 (36.02%), Postives = 89/161 (55.28%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDVKN-RQVKAKQVTFHRKKN-LQYYEISAKSNYNFEKPFLYLARKL 556
            FKLV++G+   GK++ V R + G+F +  E TIG          +   ++F  WDTAGQE++  L   YY   Q AI+++D+T + T+    TW ++L R    +I I L GNK D+ N R V+ ++   +   N L + E SAK+  N    FL +A+KL
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKL 181          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB5B_HUMAN (Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.096e-20
Identity = 58/161 (36.02%), Postives = 89/161 (55.28%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDVKN-RQVKAKQVTFHRKKN-LQYYEISAKSNYNFEKPFLYLARKL 556
            FKLV++G+   GK++ V R + G+F +  E TIG          +   ++F  WDTAGQE++  L   YY   Q AI+++D+T + T+    TW ++L R    +I I L GNK D+ N R V+ ++   +   N L + E SAK+  N    FL +A+KL
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKL 181          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB10_DISOM (Ras-related protein Rab-10 OS=Discopyge ommata PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.096e-20
Identity = 56/185 (30.27%), Postives = 99/185 (53.51%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-RVCENIPIVLCGNKVDVKNRQV--KAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLA 628
            FKL+++GD G GKT  + R     F   +  TIG++        +  KI+   WDTAGQE+F  +   YY      ++++D+T   +++N+  W R++     E++  +L GNK D+++++V  K+K     R+  ++++E SAK+N N EK FL LA  +         ++P   P    +D++
Sbjct:   10 FKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELHGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVLKSKGEQIAREHAIRFFETSAKANINIEKAFLTLAEDI-------LQKTPVKEPDRENVDIS 187          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RB2BV_BETVU (Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.349e-20
Identity = 59/189 (31.22%), Postives = 93/189 (49.21%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLADSNT 640
            FK+V++GD G GK+  + R    EF  + + TIGVE            ++   WDTAGQE++  +   YY     A++++D+T R T+ NV  W R+L      NI I++ GNK D+K+ +  +++       K+ L + E SA    N EK F  +  ++      H +   ALA  E   +L    T
Sbjct:   13 FKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFDNVQRWLRELRDHADSNIVIMMAGNKSDLKHLRAVSEEDGQALAEKEGLSFLETSALEAVNIEKAFQTILTEI-----YHIISKKALAAQEASSNLPGQGT 196          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB5C_MOUSE (Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 5.349e-20
Identity = 65/194 (33.51%), Postives = 103/194 (53.09%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCR-VCENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN-LQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQ-IDLADSNT*SRA 652
            FKLV++G+   GK++ V R + G+F +  E TIG          +   ++F  WDTAGQE++  L   YY   Q AI+++D+T   T+     W ++L R    NI I L GNK D+   R V+ ++   +   N L + E SAK+  N  + F+ +A+KL  +      ++ A AP   + +DL +SN  SR+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE----PQNAAGAPGRTRGVDLQESNPASRS 211          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB19_RAT (Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.987e-20
Identity = 58/176 (32.95%), Postives = 96/176 (54.55%), Query Frame = 2
Query:   62 QTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRV-CENIPIVLCGNKVDV-KNRQVKAKQVTFHRKKN--LQYYEISAKSNYNFEKPFLYLARKLAGDPNLH 577
            + VDY  FK++++GD   GKT  V+   +G + +  + TIGV+        +  K++   WDTAGQE+F  +   YY     AII +D+T R T+++VP W  ++ +    N+ I+L GNK D+ + R V  +      +K   L   E SAK + N ++ F+ +A++L    +LH
Sbjct:   12 ENVDY-LFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLWEKRHVLFEDACTLAEKYGLLAVLETSAKESRNIDEVFVLMAKELIARNSLH 186          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB7_VIGAC (Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 9.125e-20
Identity = 52/188 (27.66%), Postives = 96/188 (51.06%), Query Frame = 2
Query:   86 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVC-----ENIPIVLCGNKVDV---KNRQVKAKQVT--FHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG---DPNLHFVESPALAPPE 610
            K++++GD G GKT+ + +++  +F ++Y+ TIG +    +   +   +    WDTAGQE+F  L   +Y    C ++ +DV    ++  +  WH +  +        + P +L GNK+D+    +R V  K+       K N+ Y+E SAK ++N +  FL +A+       + +++F   P  A PE
Sbjct:   10 KVIVLGDTGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQSLGVAFYRGADCCVLAYDVNVMKSFDTLDNWHEEFLKQANPPDPRSFPFILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDFNVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPE 197          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB18_DICDI (Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 9.125e-20
Identity = 57/165 (34.55%), Postives = 89/165 (53.94%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVC--ENIPIVLCGNKVDVKNRQVKAKQ-VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDP 568
            +K++++GD   GKT+ VKR     F++    TIGVE    +   +  K+    WDTAGQEKF  L   YY      I+ +DVT R ++ N+  W  ++       N+  +L GNK+D +NR+V  ++   F +KK + + E SAKS    ++ F  LA+K+   P
Sbjct:    7 YKVLLIGDSDVGKTSIVKRFSDDTFDEDLLCTIGVEFKMKEVKVDGKKVDLCIWDTAGQEKFRALISSYYRGAHGIILTYDVTKRESFDNLNYWLNEVENFANRSNLVKLLVGNKIDKENREVTREEGAEFAKKKAMLFIECSAKSKIGIQQAFEELAQKIIEIP 171          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB35_RAT (Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.192e-19
Identity = 53/153 (34.64%), Postives = 82/153 (53.59%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPF 535
            FKL+I+GD G GK++ + R     F   Y  TIGV+        N  K++   WDTAGQE+F  +   YY      I+++DVT+  ++ NV  W  ++ + C+++  +L GNK D   R+V   +    F  +  +Q +E SAK N N E+ F
Sbjct:    9 FKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMF 161          
BLAST of DC900183 vs. ExPASy Swiss-Prot
Match: RAB35_MOUSE (Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.192e-19
Identity = 53/153 (34.64%), Postives = 82/153 (53.59%), Query Frame = 2
Query:   83 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPF 535
            FKL+I+GD G GK++ + R     F   Y  TIGV+        N  K++   WDTAGQE+F  +   YY      I+++DVT+  ++ NV  W  ++ + C+++  +L GNK D   R+V   +    F  +  +Q +E SAK N N E+ F
Sbjct:    9 FKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMF 161          
The following BLAST results are available for this feature:
BLAST of DC900183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAB5B_MOUSE4.096e-2036.02Ras-related protein Rab-5B OS=Mus musculus GN=Rab5... [more]
RAB5B_HUMAN4.096e-2036.02Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5... [more]
RAB10_DISOM4.096e-2030.27Ras-related protein Rab-10 OS=Discopyge ommata PE=... [more]
RB2BV_BETVU5.349e-2031.22Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB... [more]
RAB5C_MOUSE5.349e-2033.51Ras-related protein Rab-5C OS=Mus musculus GN=Rab5... [more]
RAB19_RAT6.987e-2032.95Ras-related protein Rab-19 OS=Rattus norvegicus GN... [more]
RAB7_VIGAC9.125e-2027.66Ras-related protein Rab7 OS=Vigna aconitifolia PE=... [more]
RAB18_DICDI9.125e-2034.55Ras-related protein Rab-18 OS=Dictyostelium discoi... [more]
RAB35_RAT1.192e-1934.64Ras-related protein Rab-35 OS=Rattus norvegicus GN... [more]
RAB35_MOUSE1.192e-1934.64Ras-related protein Rab-35 OS=Mus musculus GN=Rab3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900183 VSS Citrus sinensis cDNA clone VS28210 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900183 ID=DC900183|Name=DC900183|organism=Citrus sinensis|type=EST|length=672bp
CAGACCGCGAACTTCGTATTCTTTCGCACACAGTACTCAACTCATGGCTC
TGCCAAGTCAGCAAACTGTTGATTACCCGAGCTTCAAACTCGTCATAGTC
GGCGACGGTGGCACTGGGAAGACTACCTTTGTGAAGAGGCATCTGACTGG
GGAGTTTGAGAAGAAGTATGAACCAACTATTGGTGTGGAGGTTCATCCGT
TGGATTTCTTTACAAATTGTGGCAAAATCCGTTTCTACTGCTGGGACACT
GCTGGCCAGGAAAAGTTTGGTGGTCTTAGAGATGGTTATTACATCCATGG
GCAATGTGCCATCATTATGTTTGATGTTACTGCCCGATTGACATACAAGA
ATGTTCCCACTTGGCACCGTGATCTTTGCCGGGTGTGTGAAAATATACCG
ATTGTTCTCTGTGGGAACAAGGTTGATGTGAAGAATAGGCAAGTCAAGGC
AAAGCAGGTTACCTTCCACAGGAAGAAGAATCTACAGTACTATGAGATTT
CTGCCAAGAGCAACTACAATTTTGAGAAACCTTTCTTGTACCTTGCCAGG
AAGCTTGCTGGGGACCCAAATTTGCACTTCGTGGAATCTCCTGCTCTCGC
TCCTCCAGAAGTACAGATTGACTTAGCTGACAGCAACACATGAAGCCGAG
CTTGCCGANCAGCTAGCCAGCC
back to top