DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_HUMAN (Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4)

HSP 1 Score: 151.754 bits (382), Expect = 3.815e-36
Identity = 67/143 (46.85%), Postives = 102/143 (71.33%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            AK+ G TE +NP+D+  P+Q+V+ +MT+GGVD S EC G+V+ M +A E  H GWGV+V+VGV    +   T P  L+  RT KGT FG +K    +P +V +YM+K+++V++F+TH + F EINKAF+LM +G+SIR ++++
Sbjct:  232 AKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_UROHA (Alcohol dehydrogenase class-3 OS=Uromastyx hardwickii PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 8.499e-36
Identity = 67/143 (46.85%), Postives = 102/143 (71.33%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            +AK+ G TE ++P D+  P+Q+V+ +MT+GGVD S EC G+V  M +A E  H GWGV+V+VGV        T P  L+  RT KGT FG +K    +P +V++YM+K+++V++F+THT+PF +IN+AF+LM AG+SIR +++
Sbjct:  230 KAKEFGATECISPADFKKPIQEVLIEMTDGGVDYSFECIGNVGVMRAALEACHKGWGVSVIVGVAAAGQEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVDEYMSKKMKVDEFVTHTLPFEQINEAFELMHAGKSIRSVLK 372          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_HORSE (Alcohol dehydrogenase class-3 OS=Equus caballus GN=ADH5 PE=1 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 1.110e-35
Identity = 65/144 (45.14%), Postives = 104/144 (72.22%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +AK+ G +E +NP+D+  P+Q+V+ +MT+GGVD S EC G+V+ M +A E  H GWGV+V+VGV    +   T P  L+  RT KGT FG +K    +P +V +YM+K+++V++F+TH++ F +IN+AF+LM AG+SIR ++++
Sbjct:  231 KAKEFGASECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESIPKLVSEYMSKKIKVDEFVTHSLSFDQINEAFELMHAGKSIRTVVKL 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHL6_ARATH (Alcohol dehydrogenase-like 6 OS=Arabidopsis thaliana GN=At5g24760 PE=2 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 4.218e-35
Identity = 68/144 (47.22%), Postives = 93/144 (64.58%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +AK  GVT+F+N  D   P+ QVI  MT GG D S EC G      +A +   DGWG+ V +GVP        H    L+ ++LKGT FG +KP+SDLPS+++KYMNKE+ +++FITH + F EINKAF LM  G+ +RC++ M
Sbjct:  236 QAKTFGVTDFINSNDLSEPIPQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGWGMTVTLGVPKAKPEVSAHYGLFLSGKSLKGTLFGGWKPKSDLPSLIDKYMNKEIMIDEFITHNLSFDEINKAFVLMREGKCLRCVLHM 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_RAT (Alcohol dehydrogenase class-3 OS=Rattus norvegicus GN=Adh5 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 5.509e-35
Identity = 67/144 (46.53%), Postives = 100/144 (69.44%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +AK+ G TE +NP+D+   +Q+V+ +MT+GGVD S EC G+V+ M SA E  H GWGV+V+VGV    +   T P  L+  RT KGT FG +K    +P +V +YM+K+++V++F+T  + F +INKAFDLM +G SIR +++M
Sbjct:  231 KAKEFGATECINPQDFSKSIQEVLIEMTDGGVDFSFECIGNVKVMRSALEAAHKGWGVSVVVGVAASGEEISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTGNLSFDQINKAFDLMHSGNSIRTVLKM 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_SYNY3 (S-(hydroxymethyl)glutathione dehydrogenase OS=Synechocystis sp. (strain PCC 6803) GN=frmA PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.227e-34
Identity = 69/141 (48.94%), Postives = 92/141 (65.25%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            AK+ G T+ +NPKD+D P+QQVI +MT  GVD S EC G+V+ M SA EC H GWG +V++GV        T P  L+  R   GT FG  K RS LP +VE+ M  E+++  F+THT+   +IN+AFDLM  G+SIR +I
Sbjct:  227 AKQMGATDCINPKDHDQPIQQVIVEMTGWGVDHSFECIGNVEVMRSALECAHRGWGQSVIIGVAGAGQEISTRPFQLVTGRKWMGTAFGGVKGRSQLPGMVEQSMRGEIQLAPFVTHTMELKDINQAFDLMHDGKSIRSVI 367          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_RABIT (Alcohol dehydrogenase class-3 OS=Oryctolagus cuniculus GN=ADH5 PE=2 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 1.227e-34
Identity = 64/143 (44.76%), Postives = 101/143 (70.63%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            AK+ G TE +NP+D+  P+Q+V+ + T+GGVD S EC G+V+ M +A E  H GWGV+V+VGV    +   T P  L+  RT KGT FG +K    +P +V +YM+K++ V++F+T+T+ F +IN+AF+LM +G+SIR ++++
Sbjct:  232 AKEFGATECINPQDFSKPIQEVLVEKTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAGAGEEISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKINVDEFVTNTLSFDQINEAFELMHSGKSIRTVVKI 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_MOUSE (Alcohol dehydrogenase class-3 OS=Mus musculus GN=Adh5 PE=1 SV=3)

HSP 1 Score: 144.436 bits (363), Expect = 6.091e-34
Identity = 64/144 (44.44%), Postives = 101/144 (70.14%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +AK+ G +E ++P+D+   +Q+V+ +MT+GGVD S EC G+V+ M SA E  H GWGV+V+VGV    +   T P  L+  RT KGT FG +K    +P +V +YM+K+++V++F+T  + F +IN+AFDLM +G+SIR +++M
Sbjct:  231 KAKEFGASECISPQDFSKSIQEVLVEMTDGGVDYSFECIGNVKVMRSALEAAHKGWGVSVVVGVAASGEEISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTGNLSFDQINQAFDLMHSGDSIRTVLKM 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_OCTVU (Alcohol dehydrogenase class-3 OS=Octopus vulgaris PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.156e-33
Identity = 66/140 (47.14%), Postives = 94/140 (67.14%), Query Frame = 1
Query:   31 KKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            KK G+TEFVNPK +   VQ+V+ +MT+ GVD + EC G+V  M +A E  H GWG +V+VGV    +   T P  L+  R  KGT FG +K R  +P +V+ YMNK+L +++F++H + F +IN+AFDLM  GESIR ++
Sbjct:  235 KKFGITEFVNPKKFCKSVQKVLGEMTDVGVDFTFECIGNVGVMRAALESCHKGWGTSVIVGVAAHGEEISTRPFQLVTGRVWKGTAFGGFKSRDSVPKLVDDYMNKKLLLDEFVSHKLSFKKINEAFDLMHKGESIRAVL 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_PASPI (S-(hydroxymethyl)glutathione dehydrogenase OS=Pasteurella piscicida GN=frmA PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.795e-33
Identity = 67/141 (47.52%), Postives = 90/141 (63.83%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            AK+ G T+ +NP DYD PVQQV+ +MT  GVD + EC G+V  M SA E  H GWG +V++GV        T P  L+  R  KGT FG  K R+ LP +VE  M+ ++E+  F+THT+   +IN+AFDLM  G+SIR +I
Sbjct:  227 AKQFGATDCINPNDYDKPVQQVLVEMTKWGVDHTFECIGNVNVMRSALESAHRGWGQSVIIGVAGAGKEISTRPFQLVTGRVWKGTAFGGVKGRTQLPGMVEDAMSGKIELAPFVTHTMELDKINEAFDLMHDGKSIRTVI 367          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADHX_HUMAN3.815e-3646.85Alcohol dehydrogenase class-3 OS=Homo sapiens GN=A... [more]
ADHX_UROHA8.499e-3646.85Alcohol dehydrogenase class-3 OS=Uromastyx hardwic... [more]
ADHX_HORSE1.110e-3545.14Alcohol dehydrogenase class-3 OS=Equus caballus GN... [more]
ADHL6_ARATH4.218e-3547.22Alcohol dehydrogenase-like 6 OS=Arabidopsis thalia... [more]
ADHX_RAT5.509e-3546.53Alcohol dehydrogenase class-3 OS=Rattus norvegicus... [more]
FRMA_SYNY31.227e-3448.94S-(hydroxymethyl)glutathione dehydrogenase OS=Syne... [more]
ADHX_RABIT1.227e-3444.76Alcohol dehydrogenase class-3 OS=Oryctolagus cunic... [more]
ADHX_MOUSE6.091e-3444.44Alcohol dehydrogenase class-3 OS=Mus musculus GN=A... [more]
ADHX_OCTVU5.156e-3347.14Alcohol dehydrogenase class-3 OS=Octopus vulgaris ... [more]
FRMA_PASPI8.795e-3347.52S-(hydroxymethyl)glutathione dehydrogenase OS=Past... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top