DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_DROME (Alcohol dehydrogenase class-3 OS=Drosophila melanogaster GN=Fdh PE=1 SV=3)

HSP 1 Score: 140.198 bits (352), Expect = 1.149e-32
Identity = 69/144 (47.92%), Postives = 93/144 (64.58%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDY--DXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            AKK G T+FVNPKD      +Q  + D+T+GG D + EC G+V  M SA E  H GWG +V++GV        T P  L+  R  KG+ FG ++  SD+P +VE Y+ K+L V++FITH +P S+IN+AFDLM  GESIR II+
Sbjct:  235 AKKFGFTDFVNPKDVADKGSIQNYLIDLTDGGFDYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQEISTRPFQLVVGRVWKGSAFGGWRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKGESIRSIIK 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_DICDI (Alcohol dehydrogenase class-3 OS=Dictyostelium discoideum GN=adh5 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.559e-32
Identity = 67/146 (45.89%), Postives = 95/146 (65.07%), Query Frame = 1
Query:   31 KKXGVTEFVNPKDYDXP----VQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            K  G TEF+NP   D P    +QQ + D+T+GGVD S EC G+V  M +A EC H GWGV+ +VGV        T P  L+  R  KG+ FG  K RS LPS+++KYM+K+L+V++++T T P +EIN AFD+M  G+S+R ++ +
Sbjct:  235 KDFGCTEFINPSK-DLPEGKTIQQHLVDITDGGVDYSFECIGNVNVMRAALECCHKGWGVSTIVGVAPAGAEISTRPFQLVTGRVWKGSAFGGVKSRSQLPSIIDKYMDKKLKVDEYVTFTYPLNEINTAFDVMHEGKSLRSVVNL 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1E_HORSE (Alcohol dehydrogenase E chain OS=Equus caballus PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 3.342e-32
Identity = 63/142 (44.37%), Postives = 94/142 (66.20%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE VNP+DY  P+Q+V+ +M+NGGVD S E  G +  M++A  C  + +GV+V+VGVP        +PM LL+ RT KG  FG +K +  +P +V  +M K+  ++  ITH +PF +IN+ FDL+ +GESIR I+
Sbjct:  232 KAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTIL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHL3_ARATH (Alcohol dehydrogenase-like 3 OS=Arabidopsis thaliana GN=At1g32780 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.701e-32
Identity = 64/147 (43.54%), Postives = 94/147 (63.95%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +  + K  GVT+F+NPKD   PV Q+I ++T GGVD S ECTG+V  +  AF   H GWG  VLVG+         HPM L + R + G+ FG +KP+S LP+  ++ M   +++E FIT+ +PF +IN AF L+  G+S+RCI+++
Sbjct:  242 KFEKGKLMGVTDFINPKDLTKPVHQMIREITGGGVDYSFECTGNVDVLREAFLSTHVGWGSTVLVGIYPTPRTLPLHPMELFDGRRITGSVFGGFKPKSQLPNFAQQCMKGVVKLEPFITNELPFEKINDAFQLLRDGKSLRCILQI 388          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1S_HORSE (Alcohol dehydrogenase S chain OS=Equus caballus PE=1 SV=3)

HSP 1 Score: 137.117 bits (344), Expect = 9.724e-32
Identity = 62/142 (43.66%), Postives = 94/142 (66.20%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE VNP+DY  P+Q+V+ +M+NGGVD S E  G +  M++A  C  + +GV+V+VGVP        +PM LL+ RT KG  FG +K +  +P +V  +M K+  ++  ITH +PF +IN+ FDL+ +G+SIR I+
Sbjct:  231 KAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGKSIRTIL 372          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_SHISS (S-(hydroxymethyl)glutathione dehydrogenase OS=Shigella sonnei (strain Ss046) GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOUT (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOSM (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOLC (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOL6 (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6 GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADHX_DROME1.149e-3247.92Alcohol dehydrogenase class-3 OS=Drosophila melano... [more]
ADHX_DICDI2.559e-3245.89Alcohol dehydrogenase class-3 OS=Dictyostelium dis... [more]
ADH1E_HORSE3.342e-3244.37Alcohol dehydrogenase E chain OS=Equus caballus PE... [more]
ADHL3_ARATH5.701e-3243.54Alcohol dehydrogenase-like 3 OS=Arabidopsis thalia... [more]
ADH1S_HORSE9.724e-3243.66Alcohol dehydrogenase S chain OS=Equus caballus PE... [more]
FRMA_SHISS1.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Shig... [more]
FRMA_ECOUT1.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
FRMA_ECOSM1.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
FRMA_ECOLC1.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
FRMA_ECOL61.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top