DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOL5 (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOK1 (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOHS (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECO57 (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O157:H7 GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECO24 (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=frmA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_GEOKN (Alcohol dehydrogenase 1 OS=Geomys knoxjonesi GN=ADH1 PE=2 SV=3)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 65/142 (45.77%), Postives = 94/142 (66.20%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE VNP+DYD P+ QV+ +MT+GGVD S E  G +  M+SA  C  +  GV+V+VGVP    +    PM LL+ R+ KG  FG YK + D+P +V  +M K+  +E  IT+  PF++IN+ FDL+ AG+SIR ++
Sbjct:  232 KAKELGATECVNPQDYDKPIYQVLQEMTDGGVDFSFEVIGRLDTMVSALMCCQESHGVSVIVGVPPNAQSLTMDPMVLLSGRSWKGAVFGGYKGKDDVPKLVADFMAKKFPLEPLITNVFPFAKINEGFDLLRAGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_GEOBU (Alcohol dehydrogenase 1 OS=Geomys bursarius GN=ADH1 PE=2 SV=3)

HSP 1 Score: 136.732 bits (343), Expect = 1.270e-31
Identity = 65/142 (45.77%), Postives = 94/142 (66.20%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE VNP+DYD P+ QV+ +MT+GGVD S E  G +  M+SA  C  +  GV+V+VGVP    +    PM LL+ R+ KG  FG YK + D+P +V  +M K+  +E  IT+  PF++IN+ FDL+ AG+SIR ++
Sbjct:  232 KAKELGATECVNPQDYDKPIYQVLQEMTDGGVDFSFEVIGRLDTMVSALMCCQESHGVSVIVGVPPNAQSLTMDPMVLLSGRSWKGAVFGGYKGKDDVPKLVADFMAKKFPLEPLITNVFPFAKINEGFDLLRAGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_HAEIN (S-(hydroxymethyl)glutathione dehydrogenase OS=Haemophilus influenzae GN=frmA PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.695e-31
Identity = 60/141 (42.55%), Postives = 89/141 (63.12%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            AK+ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M  A E  H GWG ++++GV        T P  L+  R  KG+ FG  K RS+LP +VE  M  ++++E F+THT+P  +IN+AF+LM  G+SIR +I
Sbjct:  236 AKQFGATDCLNPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRQALESAHRGWGQSIIIGVAGAGQEISTRPFQLVTGRVWKGSAFGGVKGRSELPQMVEDSMKGDIQLEPFVTHTMPLDKINEAFELMHEGKSIRTVI 376          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FRMA_ECOLI (S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain K12) GN=frmA PE=1 SV=3)

HSP 1 Score: 135.191 bits (339), Expect = 3.695e-31
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIR 453
            A++ G T+ +NP DYD P++ V+ D+   G+D + EC G+V  M +A E  H GWG +V++GV        T P  L+  R  KG+ FG  K RS LP +VE  M  ++++E F+THT+   EIN AFDLM  G+SIR +IR
Sbjct:  227 ARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAVAGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEGKSIRTVIR 368          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH4_STRCA (Alcohol dehydrogenase 4 OS=Struthio camelus GN=ADH4 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.695e-31
Identity = 64/141 (45.39%), Postives = 92/141 (65.25%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            AKK G T+ +NP+D   PVQ++IA+MTNGGVD ++EC G+   M +AFE    GWG  V+VGV   + +    PM L+  R +K TFFG +K    +P +V  YM K+ +++  ++HT+P  +IN AFDLM AG+S R I+
Sbjct:  237 AKKLGATDCLNPQDIRKPVQEIIAEMTNGGVDFAIECIGNPDVMKAAFESTTVGWGTCVIVGVAVGEQSIPFSPMQLIMGRKIKATFFGGWKSVKSVPKLVSDYMAKKFDLDALVSHTLPLDKINDAFDLMNAGKSNRTIL 377          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
FRMA_ECOL51.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
FRMA_ECOK11.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
FRMA_ECOHS1.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
FRMA_ECO571.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
FRMA_ECO241.270e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
ADH1_GEOKN1.270e-3145.77Alcohol dehydrogenase 1 OS=Geomys knoxjonesi GN=AD... [more]
ADH1_GEOBU1.270e-3145.77Alcohol dehydrogenase 1 OS=Geomys bursarius GN=ADH... [more]
FRMA_HAEIN3.695e-3142.55S-(hydroxymethyl)glutathione dehydrogenase OS=Haem... [more]
FRMA_ECOLI3.695e-3143.66S-(hydroxymethyl)glutathione dehydrogenase OS=Esch... [more]
ADH4_STRCA3.695e-3145.39Alcohol dehydrogenase 4 OS=Struthio camelus GN=ADH... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top