DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_GADCA (Alcohol dehydrogenase 1 OS=Gadus callarias PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.826e-31
Identity = 63/148 (42.57%), Postives = 98/148 (66.22%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  +AK  G T+FVNP D+  P+ QV++ MTNGGVD S+EC G+V  M +A E    GWGV+VLVG  +  D   T P+ L+  RT KG+ FG +K +  +P +V+ Y++K++++++FITH +P   +N A DLM  G+ IR ++ ++
Sbjct:  229 KFEKAKVFGATDFVNPNDHSEPISQVLSKMTNGGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGWTDLHDV-ATRPIQLIAGRTWKGSMFGGFKGKDGVPKMVKAYLDKKVKLDEFITHRMPLESVNDAIDLMKHGKCIRTVLSLE 375          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_RAT (Alcohol dehydrogenase 1 OS=Rattus norvegicus GN=Adh1 PE=1 SV=3)

HSP 1 Score: 134.035 bits (336), Expect = 8.232e-31
Identity = 63/142 (44.37%), Postives = 93/142 (65.49%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G T+ +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M SA    H   GV+V+VGVP    +   +PM+LL  RT KG  FG +K +  +P +V  +M K+  +E  ITH +PF +IN+AFDL+ AG+SIR ++
Sbjct:  233 KAKELGATDCINPQDYTKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHSACGVSVIVGVPPSAQSLSVNPMSLLLGRTWKGAIFGGFKSKDAVPKLVADFMAKKFPLEPLITHVLPFEKINEAFDLLRAGKSIRTVL 374          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1A_MACMU (Alcohol dehydrogenase 1A OS=Macaca mulatta GN=ADH1A PE=2 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 8.232e-31
Identity = 60/142 (42.25%), Postives = 93/142 (65.49%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M+++  C H+  G +V+VGVP        +PM LL  RT KG  +G +K + D+P +V  +M K+  ++  ITH +PF +IN+ FDL+ +G+SIR I+
Sbjct:  232 KAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAVYGGFKSKEDIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLRSGKSIRTIL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_PERMA (Alcohol dehydrogenase 1 OS=Peromyscus maniculatus GN=ADH1 PE=2 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 3.128e-30
Identity = 62/142 (43.66%), Postives = 92/142 (64.79%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP DY  P+Q+V+ +MT+GGVD S E  G +  M S+    H   GV+V+VGVP    +   +PM+LL  R+ KG  FG +K +  +P +V  +M K+  +E  ITH +PF +IN+AFDL+ AG+SIR ++
Sbjct:  232 KAKELGATECINPLDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSSLLSCHASCGVSVIVGVPPNAQSLSVNPMSLLMGRSWKGAIFGGFKSKDSVPKLVTDFMAKKFPLEPLITHVLPFEKINEAFDLLRAGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_ALLMI (Alcohol dehydrogenase 1 OS=Alligator mississippiensis PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.128e-30
Identity = 59/142 (41.55%), Postives = 91/142 (64.08%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP D   P+Q+V+++MT GGVD S E  G +  M +A  C  D +G +V+VGVP   +    +PM L   RT KG+ FG +K +  +P +V  YM K++ ++  ITHT+PF +IN+ F+L+  G+SIR ++
Sbjct:  231 KAKELGATECINPLDCKKPIQEVLSEMTGGGVDYSFEVIGRIDTMTAALACCQDNYGTSVIVGVPPASEKITFNPMMLFTGRTWKGSVFGGWKSKESVPKLVADYMEKKINLDGLITHTLPFDKINEGFELLRTGKSIRSVL 372          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1B_PAPHA (Alcohol dehydrogenase 1B OS=Papio hamadryas GN=ADH1B PE=2 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 3.128e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M+++  C H+  G +V+VGVP        +PM LL  RT KG  +G +K R  +P +V  +M K+  ++  ITH +PF +IN+ FDL+ +G+SIR ++
Sbjct:  232 KAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAVYGGFKSREGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLRSGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_MYXGL (Alcohol dehydrogenase class-3 OS=Myxine glutinosa PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.102e-30
Identity = 60/147 (40.82%), Postives = 94/147 (63.95%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +  +A+  G T+ V P   D P+ QV+ +MT+GG+D + EC G+V  M +A E  H GWGV+V++GV        T P  L+  RT KG  FG +K    +P +V+ YM  ++ V++F++H++PF  IN+AFDLM AG+SIR ++++
Sbjct:  230 KFEKARIFGATDCVVPDASDKPISQVLGEMTDGGLDYTFECVGNVGIMRAALESCHKGWGVSVILGVAGGGQEISTRPFQLVTGRTWKGAAFGGWKSVESVPKLVDDYMAGKIMVDEFVSHSLPFDSINEAFDLMHAGKSIRTVLQL 376          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1B_PANTR (Alcohol dehydrogenase 1B OS=Pan troglodytes GN=ADH1B PE=2 SV=3)

HSP 1 Score: 130.568 bits (327), Expect = 9.102e-30
Identity = 58/142 (40.85%), Postives = 92/142 (64.79%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M+++  C H+  G +V+VGVP        +PM LL  RT KG  +G +K +  +P +V  +M K+  ++  ITH +PF +IN+ FDL+ +G+SIR ++
Sbjct:  232 KAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1B_HUMAN (Alcohol dehydrogenase 1B OS=Homo sapiens GN=ADH1B PE=1 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 9.102e-30
Identity = 58/142 (40.85%), Postives = 92/142 (64.79%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M+++  C H+  G +V+VGVP        +PM LL  RT KG  +G +K +  +P +V  +M K+  ++  ITH +PF +IN+ FDL+ +G+SIR ++
Sbjct:  232 KAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_MOUSE (Alcohol dehydrogenase 1 OS=Mus musculus GN=Adh1 PE=2 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 1.552e-29
Identity = 62/142 (43.66%), Postives = 91/142 (64.08%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK+ G TE +NP+DY  P+Q+V+ +MT+GGVD S E  G +  M SA    H   GV+V+VGVP        +PM LL  RT KG  FG +K +  +P +V  +M K+  ++  ITH +PF +IN+AFDL+ +G+SIR ++
Sbjct:  232 KAKELGATECINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEAFDLLRSGKSIRTVL 373          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADH1_GADCA4.826e-3142.57Alcohol dehydrogenase 1 OS=Gadus callarias PE=1 SV... [more]
ADH1_RAT8.232e-3144.37Alcohol dehydrogenase 1 OS=Rattus norvegicus GN=Ad... [more]
ADH1A_MACMU8.232e-3142.25Alcohol dehydrogenase 1A OS=Macaca mulatta GN=ADH1... [more]
ADH1_PERMA3.128e-3043.66Alcohol dehydrogenase 1 OS=Peromyscus maniculatus ... [more]
ADH1_ALLMI3.128e-3041.55Alcohol dehydrogenase 1 OS=Alligator mississippien... [more]
ADH1B_PAPHA3.128e-3041.55Alcohol dehydrogenase 1B OS=Papio hamadryas GN=ADH... [more]
ADHX_MYXGL9.102e-3040.82Alcohol dehydrogenase class-3 OS=Myxine glutinosa ... [more]
ADH1B_PANTR9.102e-3040.85Alcohol dehydrogenase 1B OS=Pan troglodytes GN=ADH... [more]
ADH1B_HUMAN9.102e-3040.85Alcohol dehydrogenase 1B OS=Homo sapiens GN=ADH1B ... [more]
ADH1_MOUSE1.552e-2943.66Alcohol dehydrogenase 1 OS=Mus musculus GN=Adh1 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top