DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHQ_RABIT (Alcohol dehydrogenase class-2 isozyme 2 OS=Oryctolagus cuniculus GN=ADH2-2 PE=2 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.607e-26
Identity = 57/142 (40.14%), Postives = 86/142 (60.56%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK  G T+ +NP++ + PVQ VI +MTNGGVD +++C G  + M +  +C   GWG    VGV   D      P+ L+  RTL+G+ FG +     +P +V  Y N +  +E  +THT+PF +IN+A DL+  G+SIR I+
Sbjct:  237 KAKALGATDCLNPRELNKPVQDVIVEMTNGGVDFAIDCAGGSEVMKATVDCTTVGWGSCTFVGVNVNDKGLTISPVELILGRTLRGSSFGGWDV-DTVPKLVSDYKNGKFNLEALVTHTLPFEKINEALDLLKQGKSIRTIL 377          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHP_RABIT (Alcohol dehydrogenase class-2 isozyme 1 OS=Oryctolagus cuniculus GN=ADH2-1 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 2.098e-26
Identity = 56/142 (39.44%), Postives = 88/142 (61.97%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +AK  G T+ +NP++ + PVQ VI +MTNGGVD +++C G  + M +  +C   GWG    VGV   D      P+ L+  RTLKGT FG +   + +P +V  Y N + +++  +THT+PF +IN+A +L+  G+SIR ++
Sbjct:  237 KAKALGATDCLNPRELNKPVQDVIVEMTNGGVDFAIDCAGGSEVMKATVDCATVGWGSCTFVGVNLADKGLTISPIELILGRTLKGTNFGGWDAET-VPKLVSDYKNGKFDLDALVTHTLPFDKINEALNLLDQGKSIRTVL 377          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHL2_ARATH (Alcohol dehydrogenase-like 2 OS=Arabidopsis thaliana GN=At1g22440 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.740e-26
Identity = 62/144 (43.06%), Postives = 86/144 (59.72%), Query Frame = 1
Query:   31 KKXGVTEFVNPKDY-DXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            K+ G+T+FVNP    +  + +VI +MT+ G D S EC G    M  AF+    G G  +++G+  K         +LL  RT+ GT FG  KP+ D+P +V++Y+ KEL +E  ITH + F EINKAF L+  G SIRCII MD
Sbjct:  242 KRFGITDFVNPALCGEKTISEVIREMTDVGADYSFECIGLASLMEEAFKSTRPGSGKTIVLGMEQKALPISLGSYDLLRGRTVCGTLFGGLKPKLDIPILVDRYLKKELNLEDLITHELSFEEINKAFHLLAEGNSIRCIIWMD 385          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHX_CAEEL (Alcohol dehydrogenase class-3 OS=Caenorhabditis elegans GN=H24K24.3 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.579e-26
Identity = 58/152 (38.16%), Postives = 85/152 (55.92%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXP----VQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +   AK  G TE +NPK  + P     Q  + +  +GG D + EC G+V  M  A E  H GWGV+ ++GV        T P  L+  RT KGT FG +K    +P +V+ YMNK+L +++FITH     +IN AFD++  GES+R ++  +
Sbjct:  231 KFESAKFFGATECINPKSVELPEGKSFQAWLVEQFDGGFDYTFECIGNVHTMRQALEAAHKGWGVSCIIGVAGAGQEIATRPFQLVTGRTWKGTAFGGWKSVESVPRLVDDYMNKKLLIDEFITHRWNIDDINTAFDVLHKGESLRSVLAFE 382          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1B_UROHA (Alcohol dehydrogenase 1B OS=Uromastyx hardwickii PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 4.674e-26
Identity = 57/147 (38.78%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   13 QQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNG-GVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            ++  +AK+ G TE VNP DY  P+ +V+ DMT+G GV+ S E  G    M +A    H+ +G +V+VGVP         P+ L   RT KG+ FG +K +  +P +V  +M K+  ++  ITHT+PF +IN+ F+L+ +G+SIR ++
Sbjct:  227 EKFPKAKELGATECVNPLDYKKPINEVLFDMTDGEGVEYSFEVIGRTDTMTAALASCHNNYGTSVIVGVPPSASQIAFDPLLLFTGRTWKGSVFGGWKSKDAVPRLVSDFMGKKFILDPLITHTMPFEKINEGFELLRSGKSIRTVL 373          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: FADH_YEAST (S-(hydroxymethyl)glutathione dehydrogenase OS=Saccharomyces cerevisiae GN=SFA1 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 6.105e-26
Identity = 58/155 (37.42%), Postives = 92/155 (59.35%), Query Frame = 1
Query:   19 INEAKKX-----GVTEFVNPKD---YDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            IN  KK      G T+FVNPK+    D  + + + +MT+GG+D + +CTG+ + M  A E  H GWG ++++GV    +   T P  L+  R  KG+ FG  K RS++  +++ Y    L+VE+FITH  PF EIN+AF+ +  G+ +R +++ D
Sbjct:  229 INNKKKQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFEDLHNGDCLRTVLKSD 383          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADHL4_ARATH (Alcohol dehydrogenase-like 4 OS=Arabidopsis thaliana GN=At1g64710 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.360e-25
Identity = 50/142 (35.21%), Postives = 89/142 (62.68%), Query Frame = 1
Query:   31 KKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            ++ G++EF+NPK+ D  V + + ++T GGV+ S EC GS++A+  AF   + G GV V++GV         HPM L   R++  + FG +KP++ LP  + + +   L ++ FI+H +PF +IN+A  L+  G+++RC++ +
Sbjct:  239 REAGISEFINPKESDKAVHERVMEITEGGVEYSFECAGSIEALREAFLSTNSGVGVTVMLGVHASPQLLPIHPMELFQGRSITASVFGGFKPKTQLPFFITQCLQGLLNLDLFISHQLPFHDINEAMQLLHQGKALRCLLHL 380          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH8_RANPE (NADP-dependent alcohol dehydrogenase OS=Rana perezi GN=ADH8 PE=1 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 1.776e-25
Identity = 54/142 (38.03%), Postives = 93/142 (65.49%), Query Frame = 1
Query:   25 EAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +A + G TE +NPKDYD P+ +VI + TNGGVD +VEC G ++ M++A +  + G GV V++G+ + ++     P+ LL  R+LKG+ FG +K   ++  +V+ YM K++ V   ++  +   +INKAF+L+ +G+ +R I+
Sbjct:  231 KAIELGATECLNPKDYDKPIYEVICEKTNGGVDYAVECAGRIETMMNALQSTYCGSGVTVVLGLASPNERLPLDPLLLLTGRSLKGSVFGGFK-GEEVSRLVDDYMKKKINVNFLVSTKLTLDQINKAFELLSSGQGVRSIM 371          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH7_MOUSE (Alcohol dehydrogenase class 4 mu/sigma chain OS=Mus musculus GN=Adh7 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.320e-25
Identity = 52/145 (35.86%), Postives = 87/145 (60.00%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +  +A   G TE ++PKD   P+ +V++DMT   V  + E  G ++ M+ A    H  +G +V+VG P         PM L   RT KG  FG +K R D+P +V +++ K+ ++++ ITHT+PF+ IN+ F+L+ +G+SIR ++
Sbjct:  228 KFQKALAVGATECISPKDSTKPISEVLSDMTGNTVQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKMLTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTLPFNNINEGFELLYSGKSIRTVL 372          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH7_RAT (Alcohol dehydrogenase class 4 mu/sigma chain OS=Rattus norvegicus GN=Adh7 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 3.957e-25
Identity = 51/145 (35.17%), Postives = 86/145 (59.31%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCII 450
            +  +A   G TE +NP+D+  P+ +V++DMT   V  + E  G ++ M+ A    H  +G +V+VG P         PM L   RT KG  FG +K R D+P +V +++ K+ ++ + ITHT+PF  I++ F+L+ +G+SIR ++
Sbjct:  228 KFQKALDVGATECINPRDFTKPISEVLSDMTGNTVQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKMLSYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLGQLITHTLPFHNISEGFELLYSGQSIRTVL 372          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADHQ_RABIT1.607e-2640.14Alcohol dehydrogenase class-2 isozyme 2 OS=Oryctol... [more]
ADHP_RABIT2.098e-2639.44Alcohol dehydrogenase class-2 isozyme 1 OS=Oryctol... [more]
ADHL2_ARATH2.740e-2643.06Alcohol dehydrogenase-like 2 OS=Arabidopsis thalia... [more]
ADHX_CAEEL3.579e-2638.16Alcohol dehydrogenase class-3 OS=Caenorhabditis el... [more]
ADH1B_UROHA4.674e-2638.78Alcohol dehydrogenase 1B OS=Uromastyx hardwickii P... [more]
FADH_YEAST6.105e-2637.42S-(hydroxymethyl)glutathione dehydrogenase OS=Sacc... [more]
ADHL4_ARATH1.360e-2535.21Alcohol dehydrogenase-like 4 OS=Arabidopsis thalia... [more]
ADH8_RANPE1.776e-2538.03NADP-dependent alcohol dehydrogenase OS=Rana perez... [more]
ADH7_MOUSE2.320e-2535.86Alcohol dehydrogenase class 4 mu/sigma chain OS=Mu... [more]
ADH7_RAT3.957e-2535.17Alcohol dehydrogenase class 4 mu/sigma chain OS=Ra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top