DC900170

Overview
NameDC900170
Unique NameDC900170
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length793
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA6_ORYSJ (Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.514e-27
Identity = 48/122 (39.34%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAKD----TMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q + Q+ +L TL    + +  ++    D    T+IFN+FVFCQ+FNE N R++EK N+ +GI +N +F+ I+  T++ Q+I+VEFL  FA+T  L+   W   + I ++S  I  + KCIPV
Sbjct:  878 QGLYQLLVLATLMVIGKKLLSIEGPQSDKTINTLIFNSFVFCQVFNEINCREMEKINVLQGIFRNWIFVGILTATVIFQVIIVEFLGTFANTVPLSGELWLLSVVIGSISMIISVILKCIPV 999          

HSP 2 Score: 44.669 bits (104), Expect = 5.514e-27
Identity = 22/47 (46.81%), Postives = 28/47 (59.57%), Query Frame = 2
Query:   68 CFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSE 205
            C     PLTAVQLLWV +IM       +ATE P  ++M +PPV R +
Sbjct:  818 CIIGSAPLTAVQLLWVNMIMDTLGALALATEPPNDEMMKRPPVRRGD 864          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA4_ARATH (Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 9.341e-27
Identity = 46/122 (37.70%), Postives = 77/122 (63.11%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQ----ESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q + Q+ +L  L    +S+  +      +  +T+IFN+FVFCQ+FNE N+R++EK N+FKG+  + +F  ++ +T+V Q+I+VEFL  FA T  L+W  W   I I +++  +  + KC+PV
Sbjct:  887 QSVYQLIVLGILNFAGKSLLKLDGPDSTAVLNTVIFNSFVFCQVFNEINSREIEKINVFKGMFNSWVFTWVMTVTVVFQVIIVEFLGAFASTVPLSWQHWLLSILIGSLNMIVAVILKCVPV 1008          

HSP 2 Score: 45.4394 bits (106), Expect = 9.341e-27
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 2
Query:   68 CFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEPSDTK 220
            C +   PLTAVQLLWV +IM       +ATE P + LM + P+AR+    TK
Sbjct:  827 CITGSAPLTAVQLLWVNMIMDTLGALALATEPPNEGLMKRAPIARTASFITK 878          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA7_ARATH (Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.002e-25
Identity = 51/122 (41.80%), Postives = 75/122 (61.48%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAK----DTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q + Q  I+  LQ K +S+FG+  S      +T+IFN FVFCQ+FNE ++R++E+ ++FKGI  N +F+ +IG T+  Q+I++EFL  FA T  L   QW   I +  +  PI    K IPV
Sbjct:  894 QAVYQFIIIWILQAKGKSMFGLVGSDSTLVLNTLIFNCFVFCQVFNEVSSREMEEIDVFKGILDNYVFVVVIGATVFFQIIIIEFLGTFASTTPLTIVQWFFSIFVGFLGMPIAAGLKKIPV 1015          

HSP 2 Score: 43.1282 bits (100), Expect = 1.002e-25
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 2
Query:   68 CFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVAR 199
            C +   PLTAVQLLWV +IM       +ATE P  +LM + PV R
Sbjct:  834 CLTGSAPLTAVQLLWVNMIMDTLGALALATEPPNNELMKRMPVGR 878          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA2_ARATH (Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.208e-25
Identity = 49/122 (40.16%), Postives = 74/122 (60.66%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAK----DTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q + Q  ++  LQ K +++FG+         +T+IFN FVFCQ+FNE ++R++E+ ++FKGI  N +F+ +IG T+  Q+I++EFL  FA T  L   QW   I I  +  PI    K IPV
Sbjct:  893 QAVYQFIVIWILQAKGKAMFGLDGPDSTLMLNTLIFNCFVFCQVFNEISSREMEEIDVFKGILDNYVFVVVIGATVFFQIIIIEFLGTFASTTPLTITQWIFSIFIGFLGMPIAAGLKTIPV 1014          

HSP 2 Score: 42.3578 bits (98), Expect = 2.208e-25
Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 2
Query:   68 CFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVAR 199
            C +   PLTAVQLLWV +IM       +ATE P  +LM + PV R
Sbjct:  833 CLTGSAPLTAVQLLWVNMIMDTLGALALATEPPNDELMKRLPVGR 877          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA2_ORYSJ (Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.873e-25
Identity = 48/134 (35.82%), Postives = 74/134 (55.22%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAKD----TMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPVSGEQLLFRQRAP 636
            Q + Q  ++  LQ + + +FG++    D    T+IFNTFVFCQ+FNE ++R++E  N+ +G+  N +FL ++  TI  Q I+V+FL  FA+T  L   QW   I    +  PI    K I V   +    +R P
Sbjct:  900 QSLYQFAVMWYLQTQGKHLFGLEGYHADIVLNTIIFNTFVFCQVFNEISSREMEDINVLRGMAGNSIFLGVLTGTIFFQFILVQFLGDFANTTPLTQQQWLISILFGFLGMPIAAAIKLIAVEPHEKADTRRTP 1033          

HSP 2 Score: 47.3654 bits (111), Expect = 2.873e-25
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 2
Query:   41 AALSSIWCCCFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVAR 199
            A L +    CF+   PLTAVQLLWV +IM       +ATE P  +LM K PV R
Sbjct:  831 ALLVNFTSACFTGDAPLTAVQLLWVNMIMDTLGALALATEPPNNNLMKKAPVGR 884          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA11_ARATH (Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 9.384e-20
Identity = 44/95 (46.32%), Postives = 67/95 (70.53%), Query Frame = 1
Query:  328 DTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPVSGEQ 612
            +T+IFN+FVFCQ+FNE N+R++EK N+F+G+ K+ +F+A++  T+  Q+I+VEFL  FA T  L+W  W  CI I ++S  +    KCIPV   +
Sbjct:  915 NTIIFNSFVFCQVFNEVNSREIEKINVFEGMFKSWVFVAVMTATVGFQVIIVEFLGAFASTVPLSWQHWLLCILIGSVSMILAVGLKCIPVESNR 1009          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: AT2B2_OREMO (Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.286e-17
Identity = 48/144 (33.33%), Postives = 77/144 (53.47%), Query Frame = 1
Query:  253 IXQVPILLTLQXKXRSIFGVQE----------SAKDTMIFNTFVFCQIFNEFNARKLE-KKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACI--GIAAMSWPIGFLFKCIPVSGEQLLFRQRAP*IT 645
            + Q+ I+ TL      IF +            S   T+IFNTFV  Q+FNE NARK+  ++N+F GI +N +F +I+  T  +Q+++V+F  K    + L+  +W  C+  G+  + W  G +   IP S  +L F +RA  +T
Sbjct:  943 VYQLIIIFTLLFVGEQIFDIDSGRNAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFAVQIVIVQFGGKPFSCQPLDLEKWMWCVFLGLGELVW--GQVIATIPNS--RLRFLRRAGQLT 1082          

HSP 2 Score: 41.5874 bits (96), Expect = 1.286e-17
Identity = 20/48 (41.67%), Postives = 29/48 (60.42%), Query Frame = 2
Query:   68 CFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEP 208
            C +   PL AVQ+LWV LIM  +    +ATE P + L+ + P  R++P
Sbjct:  881 CITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLKRKPYGRNKP 928          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ATC2_SCHPO (Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe GN=pmc1 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.167e-17
Identity = 46/120 (38.33%), Postives = 69/120 (57.50%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAKD--TMIFNTFVFCQIFNEFNARKLEKK-NIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIP 597
            Q + Q+ + L L     SIF    +  D  T++FNTFV+ Q+FNE N R+L+ K NIF+ I+ N LF+AI  I   +Q+I+V F       +R++   WA  I    +S P+G L +C+P
Sbjct: 1021 QSMYQLAVTLVLHFAGNSIFHYPSNTADMNTIVFNTFVWLQLFNEINNRRLDNKLNIFERINHNFLFIAIFVIVAGIQVIIVFFGGAAFSVKRIDGKGWAISIVFGVISIPLGALIRCVP 1140          

HSP 2 Score: 30.8018 bits (68), Expect = 2.167e-17
Identity = 16/35 (45.71%), Postives = 22/35 (62.86%), Query Frame = 2
Query:   89 LTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPP 190
            LTAVQLLWV LIM       +AT+ P  +++ + P
Sbjct:  968 LTAVQLLWVNLIMDTLAALALATDPPTPEVLKRKP 1002          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ATC1_DICDI (Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 8.508e-13
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  331 TMIFNTFVFCQIFNEFNARKL-EKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            T++FN FVF Q+FNE NAR L  + N FK    N +F+A++  T+ +Q+I V F      T+ L   +W  C+ + A+S P+G L + IP+
Sbjct:  879 TLVFNCFVFLQLFNEINARVLGSRTNPFKNFFNNPIFIAVMIFTLGVQIIFVTFGGSATSTDSLYIVEWICCVVVGAISLPVGLLLRKIPI 969          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: AT2B4_HUMAN (Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 3.574e-11
Identity = 38/99 (38.38%), Postives = 57/99 (57.58%), Query Frame = 1
Query:  331 TMIFNTFVFCQIFNEFNARKLE-KKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAAC--IGIAAMSWPIGFLFKCIPVSGEQLL 618
            T++FNTFV  Q+FNE N+RK+  +KN+F GI++N +F +++  T + Q+ +VEF  K      L+  QW  C  IGI  + W  G     IP    + L
Sbjct:  961 TIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFSCTSLSLSQWLWCLFIGIGELLW--GQFISAIPTRSLKFL 1057          
The following BLAST results are available for this feature:
BLAST of DC900170 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
ACA6_ORYSJ5.514e-2739.34Probable calcium-transporting ATPase 6, plasma mem... [more]
ACA4_ARATH9.341e-2737.70Calcium-transporting ATPase 4, plasma membrane-typ... [more]
ACA7_ARATH1.002e-2541.80Putative calcium-transporting ATPase 7, plasma mem... [more]
ACA2_ARATH2.208e-2540.16Calcium-transporting ATPase 2, plasma membrane-typ... [more]
ACA2_ORYSJ2.873e-2535.82Calcium-transporting ATPase 2, plasma membrane-typ... [more]
ACA11_ARATH9.384e-2046.32Putative calcium-transporting ATPase 11, plasma me... [more]
AT2B2_OREMO1.286e-1733.33Plasma membrane calcium-transporting ATPase 2 (Fra... [more]
ATC2_SCHPO2.167e-1738.33Calcium-transporting ATPase 2 OS=Schizosaccharomyc... [more]
ATC1_DICDI8.508e-1339.56Calcium-transporting ATPase PAT1 OS=Dictyostelium ... [more]
AT2B4_HUMAN3.574e-1138.38Plasma membrane calcium-transporting ATPase 4 OS=H... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900170 VSS Citrus sinensis cDNA clone VS27V93 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900170 ID=DC900170|Name=DC900170|organism=Citrus sinensis|type=EST|length=793bp
TCTCACACCTTCAGAATCCTCAATTCAGCCNCAGTCATGTGCTGCTCTGT
CATCAATTTGGTGCTGCTGTTTCTCAGNAAAAGTCCCNCTAACTGCTGTT
CAGCTGCTCTGGGTGANCCTGATAATGNATCCCTGGNAGCATGGCATGGC
CACTGAGCAGCCCNCCAAAGATCTCATGTCAAAGCCTCCCGTGGCCCGAT
CCGAGCCCTCTGATACCAAACCTCATGTGNAGGAATCTCATCCCNTCAGN
CCATTNATCAGGTGCCCATCTTACTGACTCTGCAATTNAAAGNAAGATCA
ATCTTCGGCGTGCAGGAAAGTGCTAAAGATACCATGATTTTCAATACTTT
TGTCTTCTGCCAAATCTTCAATGAGTTCAATGCTAGGAAACTTGAGAAGA
AGAATATATTTAAAGGGATACACAAGAACAAGTTGTTTCTAGCAATCATT
GGAATTACCATTGTTCTTCAACTCATAATGGTAGAGTTTCTGAAGAAGTT
TGCTGATACTGAGAGGCTGAATTGGGGGCAATGGGCAGCTTGTATTGGCA
TTGCAGCTATGTCTTGGCCAATTGGTTTTCTCTTCAAGTGCATTCCCGTT
TCTGGCGAGCAGCTGCTTTTCAGGCAAAGAGCTCCATGAATCACAAATTC
ATAATCAATTCTCTATCAGTTAATATTGCCTTTTGTCTTTGTTTAGTTTC
ATAAGTTTCTTAGCTCAATTTGTAAATATAAGTCTAATAGCTAATTAGTT
CATAATGAAATTTATTTTGAACAAAAGAGAAAATTTTATTGCT
back to top