DC900170

Overview
NameDC900170
Unique NameDC900170
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length793
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: AT2B2_RAT (Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 7.963e-11
Identity = 38/94 (40.43%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  331 TMIFNTFVFCQIFNEFNARKLE-KKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAAC--IGIAAMSWPIGFLFKCIPVS 603
            T+IFNTFV  Q+FNE NARK+  ++N+F GI +N +F  I+  T  +Q+++V+F  K      L   QW  C  IG+  + W  G +   IP S
Sbjct:  996 TIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVW--GQVIATIPTS 1087          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: AT2B2_MOUSE (Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 7.963e-11
Identity = 38/94 (40.43%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  331 TMIFNTFVFCQIFNEFNARKLE-KKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAAC--IGIAAMSWPIGFLFKCIPVS 603
            T+IFNTFV  Q+FNE NARK+  ++N+F GI +N +F  I+  T  +Q+++V+F  K      L   QW  C  IG+  + W  G +   IP S
Sbjct:  951 TIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVW--GQVIATIPTS 1042          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: AT2B2_HUMAN (Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 7.963e-11
Identity = 38/94 (40.43%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  331 TMIFNTFVFCQIFNEFNARKLE-KKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAAC--IGIAAMSWPIGFLFKCIPVS 603
            T+IFNTFV  Q+FNE NARK+  ++N+F GI +N +F  I+  T  +Q+++V+F  K      L   QW  C  IG+  + W  G +   IP S
Sbjct:  996 TIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVW--GQVIATIPTS 1087          
The following BLAST results are available for this feature:
BLAST of DC900170 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
AT2B2_RAT7.963e-1140.43Plasma membrane calcium-transporting ATPase 2 OS=R... [more]
AT2B2_MOUSE7.963e-1140.43Plasma membrane calcium-transporting ATPase 2 OS=M... [more]
AT2B2_HUMAN7.963e-1140.43Plasma membrane calcium-transporting ATPase 2 OS=H... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900170 VSS Citrus sinensis cDNA clone VS27V93 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900170 ID=DC900170|Name=DC900170|organism=Citrus sinensis|type=EST|length=793bp
TCTCACACCTTCAGAATCCTCAATTCAGCCNCAGTCATGTGCTGCTCTGT
CATCAATTTGGTGCTGCTGTTTCTCAGNAAAAGTCCCNCTAACTGCTGTT
CAGCTGCTCTGGGTGANCCTGATAATGNATCCCTGGNAGCATGGCATGGC
CACTGAGCAGCCCNCCAAAGATCTCATGTCAAAGCCTCCCGTGGCCCGAT
CCGAGCCCTCTGATACCAAACCTCATGTGNAGGAATCTCATCCCNTCAGN
CCATTNATCAGGTGCCCATCTTACTGACTCTGCAATTNAAAGNAAGATCA
ATCTTCGGCGTGCAGGAAAGTGCTAAAGATACCATGATTTTCAATACTTT
TGTCTTCTGCCAAATCTTCAATGAGTTCAATGCTAGGAAACTTGAGAAGA
AGAATATATTTAAAGGGATACACAAGAACAAGTTGTTTCTAGCAATCATT
GGAATTACCATTGTTCTTCAACTCATAATGGTAGAGTTTCTGAAGAAGTT
TGCTGATACTGAGAGGCTGAATTGGGGGCAATGGGCAGCTTGTATTGGCA
TTGCAGCTATGTCTTGGCCAATTGGTTTTCTCTTCAAGTGCATTCCCGTT
TCTGGCGAGCAGCTGCTTTTCAGGCAAAGAGCTCCATGAATCACAAATTC
ATAATCAATTCTCTATCAGTTAATATTGCCTTTTGTCTTTGTTTAGTTTC
ATAAGTTTCTTAGCTCAATTTGTAAATATAAGTCTAATAGCTAATTAGTT
CATAATGAAATTTATTTTGAACAAAAGAGAAAATTTTATTGCT
back to top