DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOS7 (Chaperone protein dnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 6.266e-93
Identity = 155/212 (73.11%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLS+ EI+KMVK+AE +A  D +R+  +D +N AD  ++S
Sbjct:  329 ISEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSEIDKMVKDAEANAAEDKKRREAVDAKNHADALVHS 540          

HSP 2 Score: 44.669 bits (104), Expect = 6.266e-93
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  KI     + IEDA++DLR+A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGSKIDEGERRSIEDALSDLREALKGDDAEAIKTKSNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BARHE (Chaperone protein dnaK OS=Bartonella henselae GN=dnaK PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 8.174e-93
Identity = 157/212 (74.06%), Postives = 183/212 (86.32%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ RNQA+  I+S
Sbjct:  329 IDEVVLVGGMTRMPKIQEVVQSFFGKDPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQVFSTADDNQNAVTIRVFQGEREMANDNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEEHAAEDKKRREGVEARNQAEALIHS 540          

HSP 2 Score: 45.4394 bits (106), Expect = 8.174e-93
Identity = 19/56 (33.93%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+ +E  ++IE A++DL+  + + + +++K+K+    +   K+GQ M
Sbjct:  542 EKSLTEYGDKVSTEEKEQIETAISDLKSVLDSTDTEEVKAKMQKLAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BRUSU (Chaperone protein dnaK OS=Brucella suis GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.066e-92
Identity = 152/212 (71.70%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ+ V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGL++ +IEKMVK+AE +A+ D +R+  ++ +NQA++ ++S
Sbjct:  329 IDEVVLVGGMTRMPKIQEVVKAFFGKEPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLTDADIEKMVKDAEANAEADKKRRESVEAKNQAESLVHS 540          

HSP 2 Score: 48.9062 bits (115), Expect = 1.066e-92
Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+ ++  K IEDA+A L+ ++  ++ +DIK+K  A  +   K+GQ M
Sbjct:  542 EKSLAEYGDKVSADDKKAIEDAIAALKTSLEGEDAEDIKAKTQALAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHILO (Chaperone protein dnaK OS=Rhizobium loti GN=dnaK PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 3.088e-92
Identity = 154/212 (72.64%), Postives = 188/212 (88.68%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QE+V + FGK P KGVNPDE VALGAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQVFSTA D+Q+ V I+V QGEREMA+DNK+LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IEKMVK+AE +A+ D +R+A+++ RNQA+  ++S
Sbjct:  329 IDEVVLVGGMTRMPKIQEIVKQFFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQVFSTAEDSQSAVTIRVFQGEREMAADNKALGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEANAETDKKRRAVVEARNQAEALVHS 540          

HSP 2 Score: 42.3578 bits (98), Expect = 3.088e-92
Identity = 23/56 (41.07%), Postives = 32/56 (57.14%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+       I DA+A L+ A   D+  DI++K  A  +A  K+GQ M
Sbjct:  542 EKSLKEYGDKVSEAERTAISDAIAALKTAAEGDDAADIEAKSQALAEASMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOP5 (Chaperone protein dnaK OS=Rhodopseudomonas palustris (strain BisA53) GN=dnaK PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 5.255e-92
Identity = 153/212 (72.17%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPP+PRGMPQIEVTFDIDANGIV VSA+DKATGKEQQI I++SGGLSE +I+KMVK+AE++A  D +R+  +D +N AD  ++S
Sbjct:  329 IGEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKVLGQFDLMGIPPSPRGMPQIEVTFDIDANGIVNVSARDKATGKEQQIRIQASGGLSEADIDKMVKDAEINAAEDKKRREAVDAKNHADALVHS 540          

HSP 2 Score: 44.2838 bits (103), Expect = 5.255e-92
Identity = 21/56 (37.50%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     + IEDA++DLR+A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGAKVEEPERRAIEDALSDLREALKGDDAEAIKTKTNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_NITHX (Chaperone protein dnaK OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dnaK PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 5.256e-92
Identity = 154/212 (72.64%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQVFSTA D+Q  V I+V QGEREMA+DNK LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLSE +I+KMVK+AE +A  D +R+  +D +N AD+ ++S
Sbjct:  329 IGEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIDRNTTIPTKKSQVFSTAEDSQNAVTIRVFQGEREMAADNKILGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIDKMVKDAEANAIEDKKRREAVDAKNHADSLVHS 540          

HSP 2 Score: 45.4394 bits (106), Expect = 5.256e-92
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  KI     + IEDAV+DL++A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGSKIEDSERRAIEDAVSDLKEALKGDDAEAIKAKTNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOP2 (Chaperone protein dnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 6.856e-92
Identity = 154/212 (72.64%), Postives = 184/212 (86.79%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLS+ +I+KMVK+AE +A  D +R+  +D +N AD  ++S
Sbjct:  329 IGEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSDIDKMVKDAEANAAEDKKRREAVDAKNHADALVHS 540          

HSP 2 Score: 43.5134 bits (101), Expect = 6.856e-92
Identity = 20/56 (35.71%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     + IEDA++DLR+++ +D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGSKVAEPERRAIEDALSDLRESLKSDDAEVIKAKTNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOCS (Chaperone protein dnaK OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaK PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 8.943e-92
Identity = 151/212 (71.23%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+ E V + FG+ P +GVNPDE VA+GAAIQGG+L+ +VK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQT V I+V QGEREMA+DNK LG+F+L+GIP APRG+PQIEVTFDIDANGIV VSAKDKATGKEQ I I++SGGLS+ +I++MVK+AE HA  D +R+ L++ RNQAD  I++
Sbjct:  329 IDEVILVGGMTRMPKIIETVKQFFGREPHRGVNPDEVVAVGAAIQGGVLKGEVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQTAVTIRVFQGEREMAADNKMLGQFDLMGIPSAPRGVPQIEVTFDIDANGIVNVSAKDKATGKEQTIRIQASGGLSDADIDRMVKDAEAHAAEDKKRRELVEARNQADGLIHT 540          

HSP 2 Score: 48.1358 bits (113), Expect = 8.943e-92
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            E++L E  +K+P       E A+A+LR AM AD+V DIK+K DA  +A  K+G+
Sbjct:  542 ERTLSENGDKLPGAEKSAAEAAIAELRTAMAADDVADIKAKTDALAQASMKLGE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BRAJA (Chaperone protein dnaK OS=Bradyrhizobium japonicum GN=dnaK PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 8.944e-92
Identity = 154/212 (72.64%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLSE +IEKMVK+AE +A+ D +R+  +  +N+AD  ++S
Sbjct:  329 IGEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIEKMVKDAEANAEADKKRREAVTAKNEADGLVHS 540          

HSP 2 Score: 44.2838 bits (103), Expect = 8.944e-92
Identity = 21/56 (37.50%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     + IEDAV+DL++A+  D+ + IK+K     +A  K+G+ M
Sbjct:  542 EKALAEHGSKVAETERRAIEDAVSDLKEALKGDDAEAIKAKTQTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_AGRT5 (Chaperone protein dnaK OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 8.944e-92
Identity = 153/212 (72.17%), Postives = 188/212 (88.68%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ FSTA DNQ+ V I+V QGEREMA DNK LG+F+LVG+PP+PRG+PQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +IEKMVK+AE +A+ D +R+A ++ +NQA++ I+S
Sbjct:  329 IDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQTFSTAEDNQSAVTIRVSQGEREMAQDNKLLGQFDLVGLPPSPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEANAEADKKRRAGVEAKNQAESLIHS 540          

HSP 2 Score: 45.8246 bits (107), Expect = 8.944e-92
Identity = 27/86 (31.40%), Postives = 43/86 (50.00%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGA--DNVDDIKSKLDAANKAVSKIGQHMXXXXXXXXXXXXXXXXEQTPEAEYEEVK 892
            EKS+ EY +K+     K IEDA+A L+ A+ A   + DDI++K     +   K+GQ +                +   +A+YEE+K
Sbjct:  542 EKSVKEYGDKVSETDRKAIEDAIASLKTAVEAAEPDADDIQAKTQTLMEVSMKLGQAIYEAQQAEAGDASAEGKDDVVDADYEEIK 627          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_RHOS76.266e-9373.11Chaperone protein dnaK OS=Rhodopseudomonas sp. (st... [more]
DNAK_BARHE8.174e-9374.06Chaperone protein dnaK OS=Bartonella henselae GN=d... [more]
DNAK_BRUSU1.066e-9271.70Chaperone protein dnaK OS=Brucella suis GN=dnaK PE... [more]
DNAK_RHILO3.088e-9272.64Chaperone protein dnaK OS=Rhizobium loti GN=dnaK P... [more]
DNAK_RHOP55.255e-9272.17Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_NITHX5.256e-9272.64Chaperone protein dnaK OS=Nitrobacter hamburgensis... [more]
DNAK_RHOP26.856e-9272.64Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_RHOCS8.943e-9271.23Chaperone protein dnaK OS=Rhodospirillum centenum ... [more]
DNAK_BRAJA8.944e-9272.64Chaperone protein dnaK OS=Bradyrhizobium japonicum... [more]
DNAK_AGRT58.944e-9272.17Chaperone protein dnaK OS=Agrobacterium tumefacien... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top