DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BARQU (Chaperone protein dnaK OS=Bartonella quintana GN=dnaK PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 1.167e-91
Identity = 156/212 (73.58%), Postives = 182/212 (85.85%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK L +F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ RNQA+  I+S
Sbjct:  329 IDEVVLVGGMTRMPKIQEVVQSFFGKDPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQVFSTADDNQNAVTIRVFQGEREMANDNKLLAQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEEHAAEDKKRREGVEARNQAEALIHS 540          

HSP 2 Score: 43.8986 bits (102), Expect = 1.167e-91
Identity = 20/56 (35.71%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +KI +E  ++IE A++DL+ A+   + +++ +K+    +   K+GQ M
Sbjct:  542 EKSLTEYGDKISTEEKEQIETAISDLKSALDGTDPEEVTAKMQKLAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BARBK (Chaperone protein dnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 1.167e-91
Identity = 153/212 (72.17%), Postives = 180/212 (84.91%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ  V I+V QGEREMA+DNK L +F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IE MVK+AE HA  D +R+  ++ +NQA+  I+S
Sbjct:  329 IDEVVLVGGMTRMPKIQEVVQNFFGKDPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTADDNQNAVTIRVFQGEREMANDNKLLAQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIENMVKDAESHAAEDKKRRENVEAKNQAEALIHS 540          

HSP 2 Score: 47.7506 bits (112), Expect = 1.167e-91
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+ +E   +IE A+ADL+  +  DN +++K+K+    +   K+GQ M
Sbjct:  542 EKSLTEYGDKVSAEDKGQIEAAIADLKAVLDGDNSEEVKAKMQKLAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GEOMG (Chaperone protein dnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.985e-91
Identity = 154/212 (72.64%), Postives = 180/212 (84.91%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            VDE +LVGGMTR+P VQ+ V EIFGK+P+KGVNPDE VA+GA IQGG+LR DVK++LLLDVTPLSLGIETLG + T+LI++NTTIP +KSQVFSTA+DNQ  V I VLQGEREMASDNK+LG FEL GIPPAPRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLS++EI+KMV+EAE HA  D +++ LI+ RN ADT  YS
Sbjct:  329 VDEVILVGGMTRMPAVQKRVQEIFGKAPNKGVNPDEVVAIGAGIQGGVLRGDVKDVLLLDVTPLSLGIETLGSVMTKLIDKNTTIPCRKSQVFSTASDNQPAVTIHVLQGEREMASDNKTLGNFELTGIPPAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEIDKMVREAESHAADDKKKRELIEARNHADTLAYS 540          

HSP 2 Score: 51.2174 bits (121), Expect = 1.985e-91
Identity = 27/54 (50.00%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL EY +KI  +  K+IE+AVA L+KAM  D+VD IK   DA  +A  K+ +
Sbjct:  542 EKSLKEYGDKIGDDEKKKIEEAVAALKKAMEGDDVDAIKQATDALTQASHKLAE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BART1 (Chaperone protein dnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 5.750e-91
Identity = 155/212 (73.11%), Postives = 183/212 (86.32%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+Q+VV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQVFSTA DNQ+ V I+V QGEREMASDNK L +F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ +NQA+  I+S
Sbjct:  329 IDEVVLVGGMTRMPKIQQVVQNFFGKDPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQVFSTADDNQSAVTIRVFQGEREMASDNKLLAQFDLVGIPPAPRGIPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEEHAAEDKKRREGVEAKNQAEALIHS 540          

HSP 2 Score: 42.3578 bits (98), Expect = 5.750e-91
Identity = 19/56 (33.93%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+  E   +IE A++DL+ A+   + +++ +K+    +   K+GQ M
Sbjct:  542 EKSLNEYGDKVSVEEKGQIEAAISDLKSALEGSDTEEVTTKMQKLAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOPB (Chaperone protein dnaK OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 5.750e-91
Identity = 152/212 (71.70%), Postives = 184/212 (86.79%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPP+PRGMPQIEVTFDIDANGIV VSA+DKATGKEQQI I++SGGLSE +I KMVK+AE++A  D +R+  +D +N AD  +++
Sbjct:  329 IGEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIPPSPRGMPQIEVTFDIDANGIVNVSARDKATGKEQQIRIQASGGLSEADINKMVKDAEINAAEDKKRREAVDAKNHADALVHT 540          

HSP 2 Score: 43.1282 bits (100), Expect = 5.750e-91
Identity = 21/56 (37.50%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     + IEDA+ DLR+A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGAKVEEGERRAIEDALGDLREALKGDDAEAIKAKSNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOPS (Chaperone protein dnaK OS=Rhodopseudomonas palustris (strain BisB5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 7.501e-91
Identity = 152/212 (71.70%), Postives = 182/212 (85.85%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPP+PRGMPQIEVTFDIDANGIV VSAKDKAT KEQQI I++SGGLS+ +I+KMVK+AE +A  D  R+  +D +N AD  ++S
Sbjct:  329 IGEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIPPSPRGMPQIEVTFDIDANGIVNVSAKDKATSKEQQIRIQASGGLSDADIDKMVKDAEANASEDKRRREAVDAKNHADALVHS 540          

HSP 2 Score: 44.2838 bits (103), Expect = 7.501e-91
Identity = 20/56 (35.71%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     + IEDA++DLR+++ +D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGSKVEDSERRAIEDALSDLRESLKSDDAEAIKTKTNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METPB (Chaperone protein dnaK OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaK PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.665e-90
Identity = 152/212 (71.70%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGG TR+PKVQEVV   FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRGMPQIEVTFDIDANGIV V+AKDKAT KE QI I++SGGLS+ +IEKMVK+AE +A+ D +R+ L++++NQ ++ I++
Sbjct:  329 IDEVVLVGGQTRMPKVQEVVKAFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGMPQIEVTFDIDANGIVNVTAKDKATNKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRELVEVKNQGESLIHA 540          

HSP 2 Score: 41.9726 bits (97), Expect = 1.665e-90
Identity = 22/58 (37.93%), Postives = 35/58 (60.34%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            A EKS+ EY +K+ +     IE A+A LR A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  540 ATEKSVSEYGDKVSAADKGAIESAIAALRTALEGDDAEGIKAKTNDLMQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHIL3 (Chaperone protein dnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 1.665e-90
Identity = 156/212 (73.58%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VALGAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ  V I+V QGEREMA+DNK LG+F+LVG+PP+PRGMPQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ RNQA++ I+S
Sbjct:  329 IDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLGQFDLVGLPPSPRGMPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEAHATEDKKRREAVEARNQAESLIHS 540          

HSP 2 Score: 37.7354 bits (86), Expect = 1.665e-90
Identity = 27/89 (30.34%), Postives = 40/89 (44.94%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGAD--NVDDIKSKLDAANKAVSKIGQHMXXXXXXXXXXXXXXXXE---QTPEAEYEEVK 892
            EKSL +Y +K+       I DA+A L+ A  A   + DDIK+K     +   K+GQ +                E      +A+YEE+K
Sbjct:  542 EKSLKDYGDKVSEADRTAISDAIAALKTASEASEPDADDIKAKTQTLMEVSMKLGQAIYEAQQAEGGAAGDASAESGDNVVDADYEEIK 630          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_SINMW (Chaperone protein dnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 3.696e-90
Identity = 154/212 (72.64%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKVQE V ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQVFSTA DNQ+ V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ EIEKMVK+AE +A+ D +R+  ++ +NQA++ ++S
Sbjct:  329 IDEVVLVGGMTRMPKVQETVKQLFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQVFSTADDNQSAVTIRVSQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEHQIRIQASGGLSDAEIEKMVKDAEANAEADKKRREGVEAKNQAESLVHS 540          

HSP 2 Score: 40.4318 bits (93), Expect = 3.696e-90
Identity = 29/91 (31.87%), Postives = 42/91 (46.15%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVD--DIKSKLDAANKAVSKIGQ-----HMXXXXXXXXXXXXXXXXEQTPEAEYEEVK 892
            EKSL E+ +K+     K IEDA+A L+ A+ A   D  DIK+K +   +   K+GQ                       +   +A+YEEVK
Sbjct:  542 EKSLQEHGDKVSETDRKAIEDAIAALKSAVEASEPDAEDIKAKTNTLMEVSMKLGQAIYEAQQTESAHADAAADAKRSGDDVVDADYEEVK 632          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_AGRVS (Chaperone protein dnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 4.822e-90
Identity = 154/212 (72.64%), Postives = 188/212 (88.68%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA DNK LG+F+LVG+PP+PRG+PQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +IEKMVK+AE +A+ D  R+A+++ +NQA++ I+S
Sbjct:  329 IDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTADDNQQAVTIRVSQGEREMAQDNKLLGQFDLVGLPPSPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEANAEADKNRRAVVEAKNQAESLIHS 540          

HSP 2 Score: 38.1206 bits (87), Expect = 4.822e-90
Identity = 25/89 (28.09%), Postives = 43/89 (48.31%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAM--GADNVDDIKSKLDAANKAVSKIGQHMXXXXXXXXXXXXXXXXEQTP---EAEYEEVK 892
            EKS+ +Y +K+ ++  K IEDA+A L+ ++     N +DI++K     +   K+GQ +                       +A+YEEVK
Sbjct:  542 EKSVKDYGDKVSADDRKAIEDAIAALKSSIETSEPNAEDIQAKTQTLMEVSMKLGQAIYESQQAEGGAEGGPSGHHDDGIVDADYEEVK 630          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_BARQU1.167e-9173.58Chaperone protein dnaK OS=Bartonella quintana GN=d... [more]
DNAK_BARBK1.167e-9172.17Chaperone protein dnaK OS=Bartonella bacilliformis... [more]
DNAK_GEOMG1.985e-9172.64Chaperone protein dnaK OS=Geobacter metallireducen... [more]
DNAK_BART15.750e-9173.11Chaperone protein dnaK OS=Bartonella tribocorum (s... [more]
DNAK_RHOPB5.750e-9171.70Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_RHOPS7.501e-9171.70Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_METPB1.665e-9071.70Chaperone protein dnaK OS=Methylobacterium populi ... [more]
DNAK_RHIL31.665e-9073.58Chaperone protein dnaK OS=Rhizobium leguminosarum ... [more]
DNAK_SINMW3.696e-9072.64Chaperone protein dnaK OS=Sinorhizobium medicae (s... [more]
DNAK_AGRVS4.822e-9072.64Chaperone protein dnaK OS=Agrobacterium vitis (str... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top