DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHILW (Chaperone protein dnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 6.290e-90
Identity = 156/212 (73.58%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VALGAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ  V I+V QGEREMA+DNK LG+F+LVG+PP+PRGMPQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ RNQA++ I+S
Sbjct:  329 IDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLGQFDLVGLPPSPRGMPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEAHATEDKKRREAVEARNQAESLIHS 540          

HSP 2 Score: 35.8094 bits (81), Expect = 6.290e-90
Identity = 26/90 (28.89%), Postives = 40/90 (44.44%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGA--DNVDDIKSKLDAANKAVSKIGQHM----XXXXXXXXXXXXXXXXEQTPEAEYEEVK 892
            EKSL +Y +K+       I DA+A L+ A  A   + DDIK+K     +   K+GQ +                    +   +A+YEE+K
Sbjct:  542 EKSLKDYGDKVSEADRTAISDAIAALKTASEATEPDADDIKAKTQTLMEVSMKLGQAIYEAQQAEGGAAAGDASAEGGDNVVDADYEEIK 631          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHIME (Chaperone protein dnaK OS=Rhizobium meliloti GN=dnaK PE=2 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.070e-89
Identity = 154/212 (72.64%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKVQE V ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQVFSTA DNQ+ V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ EIEKMVK+AE +A+ D +R+  ++ +NQA++ ++S
Sbjct:  329 IDEVVLVGGMTRMPKVQETVKQLFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQVFSTADDNQSAVTIRVSQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEHQIRIQASGGLSDAEIEKMVKDAEANAEADKKRREGVEAKNQAESLVHS 540          

HSP 2 Score: 38.891 bits (89), Expect = 1.070e-89
Identity = 28/91 (30.77%), Postives = 41/91 (45.05%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVD--DIKSKLDAANKAVSKIGQ-----HMXXXXXXXXXXXXXXXXEQTPEAEYEEVK 892
            EKSL E+ +K+     K IEDA+A L+ A+     D  DIK+K +   +   K+GQ                       +   +A+YEEVK
Sbjct:  542 EKSLQEHGDKVSETDRKAIEDAIAALKSAVEVSEPDAEDIKAKTNTLMEVSMKLGQAIYEAQQTDAAHADAAADAKRSGDDVVDADYEEVK 632          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METEP (Chaperone protein dnaK OS=Methylobacterium extorquens (strain PA1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.070e-89
Identity = 152/212 (71.70%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGG TR+PKVQEVV   FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRGMPQIEVTFDIDANGIV V+AKDKAT KE QI I++SGGLS+ +IEKMVK+AE +A+ D +R+ L++++NQ ++ I++
Sbjct:  329 IDEVVLVGGQTRMPKVQEVVKAFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGMPQIEVTFDIDANGIVNVTAKDKATNKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRELVEVKNQGESLIHA 540          

HSP 2 Score: 39.2762 bits (90), Expect = 1.070e-89
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            A EKS+ EY +K+ +     IE A+  LR A+  ++ + IK+K +   +A  K+G+ M
Sbjct:  540 ATEKSVSEYGDKVSAADKGAIESAITALRSALEGEDAEGIKAKTNDLMQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METC4 (Chaperone protein dnaK OS=Methylobacterium chloromethanicum (strain CM4 / NCIMB 13688) GN=dnaK PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.070e-89
Identity = 152/212 (71.70%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGG TR+PKVQEVV   FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRGMPQIEVTFDIDANGIV V+AKDKAT KE QI I++SGGLS+ +IEKMVK+AE +A+ D +R+ L++++NQ ++ I++
Sbjct:  329 IDEVVLVGGQTRMPKVQEVVKAFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGMPQIEVTFDIDANGIVNVTAKDKATNKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRELVEVKNQGESLIHA 540          

HSP 2 Score: 39.2762 bits (90), Expect = 1.070e-89
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            A EKS+ EY +K+ +     IE A+  LR A+  ++ + IK+K +   +A  K+G+ M
Sbjct:  540 ATEKSVAEYGDKVSAADKGAIESAITALRSALEGEDAEGIKAKTNDLMQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_XANP2 (Chaperone protein dnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.071e-89
Identity = 152/212 (71.70%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKVQEVV + FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ FSTA D QT V I+V QGEREMA+DNK LG+F+L+GIPPAPRG+PQ+EVTFDIDANGIV VSAKDK TGKEQQI I++SGGL++ +IEKMVK+AE HA  D +R+AL++ +N A+  ++S
Sbjct:  329 IDEVVLVGGMTRMPKVQEVVKQFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQTFSTAEDGQTAVTIRVFQGEREMAADNKMLGQFDLMGIPPAPRGVPQVEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLNDADIEKMVKDAEAHAAEDKKRRALVEAKNHAEALVHS 540          

HSP 2 Score: 36.1946 bits (82), Expect = 1.071e-89
Identity = 18/56 (32.14%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK++ E+ +K+ +     IE A+ADL+  +  D+V+ I +K +   +A  K+G+ M
Sbjct:  542 EKAVAEHGDKVGAVEKGAIEAALADLKSTLEGDDVEAITAKTNTLAQASLKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHIE6 (Chaperone protein dnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.396e-89
Identity = 154/212 (72.64%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VALGAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ  V I+V QGEREMA+DNK LG+F+LVG+PP+PRG+PQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ +NQA++ I+S
Sbjct:  329 IDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLGQFDLVGLPPSPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAESHAAEDKKRREAVEAKNQAESLIHS 540          

HSP 2 Score: 37.7354 bits (86), Expect = 1.396e-89
Identity = 27/90 (30.00%), Postives = 40/90 (44.44%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVD--DIKSKLDAANKAVSKIGQHMXXXXXXXXXXXXXXXXEQ----TPEAEYEEVK 892
            EKSL +Y +K+       I DA+A L+ A  A   D  DIK+K     +   K+GQ +                E+      +A+YEE+K
Sbjct:  542 EKSLKDYGDKVSEADRTAISDAIAALKSATEATEADAEDIKAKTQTLMEVSMKLGQAIYEAQQAEGGAAADASAEEGGDNVVDADYEEIK 631          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHIEC (Chaperone protein dnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 4.044e-89
Identity = 154/212 (72.64%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VALGAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ  V I+V QGEREMA+DNK LG+F+LVG+PP+PRG+PQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ +NQA++ I+S
Sbjct:  329 IDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLGQFDLVGLPPSPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAESHAAEDKKRRETVEAKNQAESLIHS 540          

HSP 2 Score: 36.1946 bits (82), Expect = 4.044e-89
Identity = 26/89 (29.21%), Postives = 39/89 (43.82%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVD--DIKSKLDAANKAVSKIGQHMXXXXXXXXXXXXXXXXE---QTPEAEYEEVK 892
            EKSL +Y +K+       I DA+A L+ +  A   D  DIK+K     +   K+GQ +                E      +A+YEE+K
Sbjct:  542 EKSLKDYGDKVSEADRTAISDAIAALKSSTEATEADAEDIKAKTQTLMEVSMKLGQAIYEAQQAEGGAAADASAEGGDNVVDADYEEIK 630          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHILE (Chaperone protein dnaK OS=Rhizobium leguminosarum GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 4.044e-89
Identity = 155/212 (73.11%), Postives = 184/212 (86.79%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM+R+PKVQEVV ++FGK P KGVNPDE VALGAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ  V I+V QGEREMA+DNK LG+F+LV +PP+PRGMPQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +IEKMVK+AE HA  D +R+  ++ RNQA++ I+S
Sbjct:  329 IDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLGQFDLVCLPPSPRGMPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEAHATEDKKRREAVEARNQAESLIHS 540          

HSP 2 Score: 36.5798 bits (83), Expect = 4.044e-89
Identity = 26/89 (29.21%), Postives = 39/89 (43.82%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGAD--NVDDIKSKLDAANKAVSKIGQ---HMXXXXXXXXXXXXXXXXEQTPEAEYEEVK 892
            EKSL +Y +K+       I DA+A L+ A  A   + DDIK+K     +   K+GQ                     +   +A+YEE+K
Sbjct:  542 EKSLKDYGDKVSEADRTAISDAIAALKTASEASEPDADDIKAKTQTLMEVSMKLGQAIYEAQQAESGAAGMPPPKAGDNVVDADYEEIK 630          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_EHRRW (Chaperone protein dnaK OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaK PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.527e-88
Identity = 152/212 (71.70%), Postives = 179/212 (84.43%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTRVPK+ + V E FGK P KGVNPDE VA+GAAIQGGIL  DV+++LLLDVTPLSLGIETLGG+FT LI RNTTIPTKKSQVFSTA D QT V IKV QGER+MA+DNK LG+F L GIPPAPRGMPQIEVTFDIDANGIV VSAKDKA+GKEQ I I+SSGGL++DEI+ M+KEAE  A+ D +RK  ++++N A+  ++S
Sbjct:  332 IDEVVLVGGMTRVPKIIQTVKEFFGKEPHKGVNPDEVVAIGAAIQGGILAGDVRDVLLLDVTPLSLGIETLGGVFTPLIERNTTIPTKKSQVFSTAEDGQTAVTIKVFQGERKMANDNKLLGQFSLEGIPPAPRGMPQIEVTFDIDANGIVHVSAKDKASGKEQAIRIQSSGGLTDDEIQNMIKEAESKAEEDEKRKKFVEVKNNAENLVHS 543          

HSP 2 Score: 40.4318 bits (93), Expect = 1.527e-88
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDD---IKSKLDAANKAVSKIGQ 802
            EKSL E+ +KI +    +IE+A+ DL+  +  DN++D   +++KLD   K   K+G+
Sbjct:  545 EKSLKEHGDKISNADKLDIENAIRDLKDCISKDNIEDTDTMQNKLDHLMKVSMKLGE 601          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_EHRRG (Chaperone protein dnaK OS=Ehrlichia ruminantium (strain Gardel) GN=dnaK PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.527e-88
Identity = 152/212 (71.70%), Postives = 179/212 (84.43%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTRVPK+ + V E FGK P KGVNPDE VA+GAAIQGGIL  DV+++LLLDVTPLSLGIETLGG+FT LI RNTTIPTKKSQVFSTA D QT V IKV QGER+MA+DNK LG+F L GIPPAPRGMPQIEVTFDIDANGIV VSAKDKA+GKEQ I I+SSGGL++DEI+ M+KEAE  A+ D +RK  ++++N A+  ++S
Sbjct:  332 IDEVVLVGGMTRVPKIIQTVKEFFGKEPHKGVNPDEVVAIGAAIQGGILAGDVRDVLLLDVTPLSLGIETLGGVFTPLIERNTTIPTKKSQVFSTAEDGQTAVTIKVFQGERKMANDNKLLGQFSLEGIPPAPRGMPQIEVTFDIDANGIVHVSAKDKASGKEQAIRIQSSGGLTDDEIQNMIKEAESKAEEDEKRKKFVEVKNNAENLVHS 543          

HSP 2 Score: 40.4318 bits (93), Expect = 1.527e-88
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDD---IKSKLDAANKAVSKIGQ 802
            EKSL E+ +KI +    +IE+A+ DL+  +  DN++D   +++KLD   K   K+G+
Sbjct:  545 EKSLKEHGDKISNADKLDIENAIRDLKDCISKDNIEDTDTMQNKLDHLMKVSMKLGE 601          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_RHILW6.290e-9073.58Chaperone protein dnaK OS=Rhizobium leguminosarum ... [more]
DNAK_RHIME1.070e-8972.64Chaperone protein dnaK OS=Rhizobium meliloti GN=dn... [more]
DNAK_METEP1.070e-8971.70Chaperone protein dnaK OS=Methylobacterium extorqu... [more]
DNAK_METC41.070e-8971.70Chaperone protein dnaK OS=Methylobacterium chlorom... [more]
DNAK_XANP21.071e-8971.70Chaperone protein dnaK OS=Xanthobacter autotrophic... [more]
DNAK_RHIE61.396e-8972.64Chaperone protein dnaK OS=Rhizobium etli (strain C... [more]
DNAK_RHIEC4.044e-8972.64Chaperone protein dnaK OS=Rhizobium etli (strain C... [more]
DNAK_RHILE4.044e-8973.11Chaperone protein dnaK OS=Rhizobium leguminosarum ... [more]
DNAK_EHRRW1.527e-8871.70Chaperone protein dnaK OS=Ehrlichia ruminantium (s... [more]
DNAK_EHRRG1.527e-8871.70Chaperone protein dnaK OS=Ehrlichia ruminantium (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top