DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_TREDE (Chaperone protein dnaK OS=Treponema denticola GN=dnaK PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 1.527e-88
Identity = 152/211 (72.04%), Postives = 176/211 (83.41%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +D+ LLVGG TR+PKV +++ EIFGK  SK VNPDEAVA+GAAIQGGIL  DVK++LLLDVTPLSLGIET+GG+FT LINRNTTIPT+KSQVFSTAAD QT V I VLQGER MAS N++LG F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I SS GLSE EI++MVKEAE +A+ D   K  ++ +N AD+ IY
Sbjct:  328 IDDILLVGGSTRMPKVLQIIKEIFGKEGSKSVNPDEAVAMGAAIQGGILGGDVKDVLLLDVTPLSLGIETMGGVFTPLINRNTTIPTRKSQVFSTAADGQTAVSIHVLQGERGMASQNRTLGNFDLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQHIRIESSSGLSESEIDRMVKEAEANAENDKLEKEKVEAKNNADSLIY 538          

HSP 2 Score: 47.3654 bits (111), Expect = 1.527e-88
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E  +KI +   ++IE A+ADLR+A+ +DN  DIK+K +   +A  KI + M
Sbjct:  541 EKTLKEMGDKIGAADKQKIEAAIADLRQALNSDNTADIKAKTENLQQAAYKIAEEM 596          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METRJ (Chaperone protein dnaK OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaK PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.527e-88
Identity = 148/212 (69.81%), Postives = 184/212 (86.79%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGM R+PK+QEVV   FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ FSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRGMPQIEVTFDIDANGIV V+AKDKAT KE QI I++SGGLS+ +I++MVK+AE +A+ D +R+ L++++NQ ++ I++
Sbjct:  329 IDEVVLVGGMIRMPKIQEVVKSFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQTFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGMPQIEVTFDIDANGIVNVTAKDKATNKEHQIRIQASGGLSDADIDRMVKDAEANAEADKKRRELVEVKNQGESLIHA 540          

HSP 2 Score: 39.6614 bits (91), Expect = 1.527e-88
Identity = 21/58 (36.21%), Postives = 35/58 (60.34%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            A EKS+ EY +K+P+     IE A+  L+ A+  D+V+ IK++     +A  K+G+ M
Sbjct:  540 ATEKSVTEYGDKVPAADKGAIETAMTALKTALEGDDVEAIKARTTDLMQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GEOSL (Chaperone protein dnaK OS=Geobacter sulfurreducens GN=dnaK PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 3.391e-88
Identity = 153/212 (72.17%), Postives = 178/212 (83.96%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            VDE +LVGGMTR+P VQ+ V EIFGK P+KGVNPDE VA+GAAIQGG+LR DVK++LLLDVTPLSLGIETLG + T+LI +NTTIP +KSQVFSTA+DNQ  V I VLQGEREMA DNK+LG FEL GIPPAPRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLS++EI+KMVKEAE H+  D +++ L++ RN ADT  YS
Sbjct:  329 VDEVILVGGMTRMPAVQKRVQEIFGKVPNKGVNPDEVVAIGAAIQGGVLRGDVKDVLLLDVTPLSLGIETLGSVMTKLIEKNTTIPCRKSQVFSTASDNQPAVTIHVLQGEREMAIDNKTLGNFELTGIPPAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEIDKMVKEAEAHSAEDKKKRELVEARNHADTLSYS 540          

HSP 2 Score: 42.3578 bits (98), Expect = 3.391e-88
Identity = 22/58 (37.93%), Postives = 36/58 (62.07%), Query Frame = 2
Query:  629 STAFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            S + EKSL EY +KI ++   +IE+ +A+LRKAM   +V+ +K   D   +A  K+ +
Sbjct:  538 SYSTEKSLKEYGDKIGADEKAKIEECLANLRKAMEGSDVEVLKKATDELTQASHKLAE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_DESDG (Chaperone protein dnaK OS=Desulfovibrio desulfuricans (strain G20) GN=dnaK PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.391e-88
Identity = 152/212 (71.70%), Postives = 177/212 (83.49%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            VDE +LVGGMTR+P VQ+ V++ FGK P++ +NPDE V++GAAIQGGIL  DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ F+TAADNQ  V I V+QGER MASDN +LG FEL GIP APRGMPQIEV+FDIDANGIV VSAKD  TGKEQ I I +S GLSEDEI+ +VKEAE HA  D ++K LI+ RNQAD+ IY+
Sbjct:  328 VDEVVLVGGMTRMPLVQKKVADFFGKEPNRSMNPDEVVSMGAAIQGGILAGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFTTAADNQPSVSIHVMQGERPMASDNMTLGRFELTGIPAAPRGMPQIEVSFDIDANGIVNVSAKDLGTGKEQSIRITASSGLSEDEIQNLVKEAEAHADEDKKKKELIEARNQADSLIYT 539          

HSP 2 Score: 42.743 bits (99), Expect = 3.391e-88
Identity = 21/56 (37.50%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL +  +K+ +++ KEIED  A L+ AM   +VD IK   D  ++A  K+ + +
Sbjct:  541 EKSLSDLGDKLEADLKKEIEDKTAALKTAMEGSDVDAIKKATDELSQASHKLAEKL 596          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_WOLPP (Chaperone protein dnaK OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dnaK PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 4.423e-88
Identity = 154/212 (72.64%), Postives = 180/212 (84.91%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKV E V E FGK P +GVNPDE VA+GAAIQ GI++ DV+++LLLDVTPLSLGIETLGG+FT LI RNTTIPTKKSQVFSTA DNQT V IKV QGER++A DNK LG+F L GIPPAPRG+PQIEVTFDIDANGI  VSAKDKATGKEQ+I I+SSGGLSEDEI +MV+EAE  AQ D +RK  I+++NQAD+ ++S
Sbjct:  328 IGEVVLVGGMTRMPKVIEKVKEFFGKDPHRGVNPDEVVAIGAAIQAGIIQGDVRDVLLLDVTPLSLGIETLGGVFTPLIERNTTIPTKKSQVFSTAEDNQTAVTIKVHQGERKLAIDNKLLGQFSLEGIPPAPRGVPQIEVTFDIDANGIAHVSAKDKATGKEQKIRIQSSGGLSEDEINRMVREAEEKAQEDEKRKKFIEVKNQADSLVHS 539          

HSP 2 Score: 40.817 bits (94), Expect = 4.423e-88
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDD---IKSKLDAANKAVSKIGQHM 808
            EKSL EY +KI  E    IE+AV +L++   +DN+DD   I+ K+   ++   K+G+ M
Sbjct:  541 EKSLTEYGDKISPEDKSAIENAVNELKEVSKSDNIDDADSIQQKVTNLSQLSMKLGEAM 599          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_MAGSA (Chaperone protein dnaK OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaK PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 4.529e-88
Identity = 159/212 (75.00%), Postives = 188/212 (88.68%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV E FG+ P KGVNPDE VA+GAAIQGG+L+ +VK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPT+KSQVFSTA DNQT V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQ+EVTFDIDANG+V VSAKDKATGKEQQI I++SGGLS+ +IEKMVKEAE HA  D +RK LI+ RN AD  I++
Sbjct:  329 IDEVILVGGMTRMPKIQEVVKEFFGREPHKGVNPDEVVAIGAAIQGGVLKGEVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTRKSQVFSTAEDNQTAVTIRVFQGEREMAADNKVLGQFDLVGIPPAPRGVPQVEVTFDIDANGLVNVSAKDKATGKEQQIRIQASGGLSDADIEKMVKEAEAHAAEDKKRKELIEARNHADGLIHT 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_MAGSM (Chaperone protein dnaK OS=Magnetococcus sp. (strain MC-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 7.525e-88
Identity = 151/212 (71.23%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKVQ VV + FGK P KGVNPDE VA+GAAIQGG+L+ +V+++LLLDVTPLSLGIETLGG+FT+LI +NTT+PT+KSQVFSTAADNQ+ V I+V QGEREM SDNK+LG+F+LVGI PAPRGMPQIEVTFDIDANG+V VSAKDK TGKEQ I I +SGGL+ +EI++MV EAE HA+ D +++ALI+ RN AD+ +YS
Sbjct:  329 IDEVILVGGMTRMPKVQAVVGQFFGKEPHKGVNPDEVVAIGAAIQGGVLKGEVQDVLLLDVTPLSLGIETLGGVFTKLIEKNTTVPTRKSQVFSTAADNQSAVTIRVAQGEREMFSDNKTLGQFDLVGIAPAPRGMPQIEVTFDIDANGMVHVSAKDKGTGKEQSIHIEASGGLTSEEIDRMVHEAESHAEEDAKKRALIEARNNADSLVYS 540          

HSP 2 Score: 34.2686 bits (77), Expect = 7.525e-88
Identity = 17/56 (30.36%), Postives = 31/56 (55.36%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL E+ +K+   +  +I  A+ DL+  M  ++ + I SK  A  +   K+G+ +
Sbjct:  542 EKSLKEHSDKLDDALKNQITAAIEDLKAVMPKEDPEAISSKTQALMELSMKMGEQI 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_PELUB (Chaperone protein dnaK OS=Pelagibacter ubique GN=dnaK PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 7.525e-88
Identity = 151/212 (71.23%), Postives = 182/212 (85.85%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE ++VGGMTR+PKV   V   FGK P+K VNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+ T+LI +NTTIPTKKSQVFSTA DNQ  V I+VLQGEREMASDNK LG FELVGI PAPRG+PQIEVTFDIDANGIV+VSAKDK TGKEQ+I I++SGGLS++EIEKMVK+AE + + D +++  +D+RNQADT ++S
Sbjct:  329 IDEIVMVGGMTRMPKVLSEVKNFFGKEPNKSVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVSTKLIEKNTTIPTKKSQVFSTADDNQPAVSIRVLQGEREMASDNKMLGNFELVGIAPAPRGVPQIEVTFDIDANGIVSVSAKDKGTGKEQKIQIQASGGLSDEEIEKMVKDAEANKEEDKKKRESVDVRNQADTLLHS 540          

HSP 2 Score: 38.5058 bits (88), Expect = 7.525e-88
Identity = 19/54 (35.19%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EK+L E+  K+     K IEDA  DL++A+   + ++IK K +   +A  K+G+
Sbjct:  542 EKNLKEHGAKVSDADKKAIEDASTDLKEAIKGTDTEEIKKKTETLVQASMKLGE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_ROSDO (Chaperone protein dnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 7.526e-88
Identity = 151/212 (71.23%), Postives = 182/212 (85.85%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKV E V++ FGK P KGVNPDE VA+GAAIQ G+L+ DVK+++LLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ+FSTA DNQ  V I+V QGEREMA+DNK LG F L  IPPAPRGMPQIEVTFDIDANGIV+V A DK TGKEQ+ITI++SGGLS+++IEKMVK+AE +A  D  R+ LI+ +NQA++ I+S
Sbjct:  329 IDEIVLVGGMTRMPKVVEEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQIFSTAEDNQNAVTIRVFQGEREMAADNKILGAFNLENIPPAPRGMPQIEVTFDIDANGIVSVGAMDKGTGKEQKITIQASGGLSDEDIEKMVKDAEENADADKARRELIEAKNQAESLIHS 540          

HSP 2 Score: 40.817 bits (94), Expect = 7.526e-88
Identity = 20/54 (37.04%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL E+ +K+     + IE A+A L+  M ++N D IKS +    +A  K+G+
Sbjct:  542 EKSLEEHSDKVDPTTVEAIELAIAALKDEMESENADKIKSGIQNVTEAAMKLGE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_WOLWR (Chaperone protein dnaK OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=dnaK PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 9.817e-88
Identity = 154/212 (72.64%), Postives = 179/212 (84.43%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKV E V E FGK P +GVNPDE VA+GAAIQ GI++ DV+++LLLDVTPLSLGIETLGG+FT LI RNTTIPTKKSQVFSTA DNQT V IKV QGER++A DNK LG+F L GIPPAPRG PQIEVTFDIDANGI  VSAKDKATGKEQ+I I+SSGGLS+DEI +MVKEAE  AQ D +RK  I+++NQAD+ ++S
Sbjct:  328 IGEVVLVGGMTRMPKVIEKVKEFFGKDPHRGVNPDEVVAIGAAIQAGIIQGDVRDVLLLDVTPLSLGIETLGGVFTPLIERNTTIPTKKSQVFSTAEDNQTAVTIKVHQGERKLAVDNKLLGQFSLEGIPPAPRGRPQIEVTFDIDANGIAHVSAKDKATGKEQKIRIQSSGGLSDDEINRMVKEAEEKAQEDEKRKKFIEVKNQADSLVHS 539          

HSP 2 Score: 40.4318 bits (93), Expect = 9.817e-88
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDD---IKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+  E    IE+AV +L++   +DN+DD   I+ K+   ++   K+G+ M
Sbjct:  541 EKSLTEYGDKVSPEDRSAIENAVNELKEVSKSDNIDDADSIQQKVTNLSQLSMKLGEAM 599          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_TREDE1.527e-8872.04Chaperone protein dnaK OS=Treponema denticola GN=d... [more]
DNAK_METRJ1.527e-8869.81Chaperone protein dnaK OS=Methylobacterium radioto... [more]
DNAK_GEOSL3.391e-8872.17Chaperone protein dnaK OS=Geobacter sulfurreducens... [more]
DNAK_DESDG3.391e-8871.70Chaperone protein dnaK OS=Desulfovibrio desulfuric... [more]
DNAK_WOLPP4.423e-8872.64Chaperone protein dnaK OS=Wolbachia pipientis subs... [more]
DNAK_MAGSA4.529e-8875.00Chaperone protein dnaK OS=Magnetospirillum magneti... [more]
DNAK_MAGSM7.525e-8871.23Chaperone protein dnaK OS=Magnetococcus sp. (strai... [more]
DNAK_PELUB7.525e-8871.23Chaperone protein dnaK OS=Pelagibacter ubique GN=d... [more]
DNAK_ROSDO7.526e-8871.23Chaperone protein dnaK OS=Roseobacter denitrifican... [more]
DNAK_WOLWR9.817e-8872.64Chaperone protein dnaK OS=Wolbachia sp. subsp. Dro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top