DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_SHEAM (Chaperone protein dnaK OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaK PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 3.367e-75
Identity = 140/212 (66.04%), Postives = 173/212 (81.60%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            ++E +LVGG TR+PKVQE V+  FGK P K VNPDEAVA+GAA+Q G+L  DVK++LLLDVTPLSLGIET+G + T+LI +NTTIPTK SQVFSTA DNQ+ V I VLQGER+ AS NKSLG+F L GI PAPRGMPQIEVTFDIDA+GI+ VSAKDK TGKEQ+ITI++S GLS++E+ +MV++AE HA  D + + L   RNQAD  +++
Sbjct:  333 INEVILVGGQTRMPKVQEAVTNFFGKEPRKDVNPDEAVAVGAAVQAGVLAGDVKDVLLLDVTPLSLGIETMGSVMTKLIEKNTTIPTKASQVFSTADDNQSAVTIHVLQGERKQASANKSLGQFNLEGIEPAPRGMPQIEVTFDIDADGILHVSAKDKKTGKEQKITIKASSGLSDEEVAQMVRDAEAHADEDKKFEELAQARNQADGLVHA 544          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RUTMC (Chaperone protein dnaK OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaK PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 3.367e-75
Identity = 137/212 (64.62%), Postives = 173/212 (81.60%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGG TR+PKV ++V + FGK P K VNPDEAVA+GAAIQ G+L  DVK++LLLDVTPLSLGIET+GGI T+LI +NTTIPT  SQ+FSTA DNQ+ V + VLQGER M+S NKSLG+F L GIP AP+G PQ+EVTFDID++GI+ VSAKDK TGKEQ ITI++S GLS++E+EKM+K+AE HA  D + + L+  +N AD+ I+S
Sbjct:  335 IDEVILVGGQTRMPKVTKMVQDFFGKEPKKDVNPDEAVAMGAAIQAGVLGGDVKDVLLLDVTPLSLGIETMGGIMTKLIEKNTTIPTNASQIFSTAVDNQSAVTVHVLQGERNMSSANKSLGQFNLEGIPNAPKGQPQVEVTFDIDSDGILDVSAKDKNTGKEQSITIKASSGLSDEEVEKMIKDAEAHADEDKKFQELVASKNMADSLIHS 546          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_LISW6 (Chaperone protein dnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 3.367e-75
Identity = 137/213 (64.32%), Postives = 169/213 (79.34%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI 639
            +D+ +LVGG TR+P VQE + +  GK P KGVNPDE VA+GAAIQGG++  DVK+++LLDVTPLSLGIET+GG+ T LI RNTTIPT KSQ FSTAADNQ  V I VLQGER MA DNK+LG F+L  IPPAPRG+PQIEV FDID NGIVTV AKD  TGKEQ I I+SS GL+++EIEKMV++AE +A+ D + K   ++RN AD  ++++
Sbjct:  304 IDQVILVGGSTRIPAVQETIKKELGKEPHKGVNPDEVVAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVMTPLIERNTTIPTSKSQTFSTAADNQPAVDIHVLQGERPMAKDNKTLGRFQLADIPPAPRGIPQIEVLFDIDKNGIVTVRAKDLGTGKEQNIVIKSSSGLTDEEIEKMVQDAEANAEEDKKNKENAELRNNADQLVFTV 516          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_LACF3 (Chaperone protein dnaK OS=Lactobacillus fermentum (strain IFO 3956 / LMG 18251) GN=dnaK PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 3.367e-75
Identity = 137/211 (64.93%), Postives = 174/211 (82.46%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +DE +L GG TR+P VQE+V  + GK P+  +NPDEAVALGAAIQGG+L  DVK+++LLDVTPLSLGIET+GG+FT+LI+RNTTIPT KSQVFSTAADNQ  V I VLQGER MA+DNK+LG F+L  IPPAPRG+PQI+VTFDID NGIV VSA+D+ T K+Q ITI+S+ GLS++EIE+M K+AE +A+ D ++K   D+RN+ D  ++
Sbjct:  307 IDEVILNGGSTRIPAVQEMVKSLTGKEPNHSINPDEAVALGAAIQGGVLTGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGNFQLTDIPPAPRGVPQIKVTFDIDKNGIVNVSAEDQGTHKKQNITIKSNSGLSDEEIERMKKDAEANAEADKKKKEEADLRNETDQLLF 517          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_CORA7 (Chaperone protein dnaK OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 3.367e-75
Identity = 141/211 (66.82%), Postives = 172/211 (81.52%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            VD  +LVGG TR+P V ++V E+ GK P+KGVNPDE VA+GAA+Q G+LR +VK++LLLDVTPLSLGIET GG+ T+LI RNTTIPTKKS+ F+TA DNQ  V I+V QGEREMAS NK LG FEL GI PAPRG+PQIEVTFDIDANGIV+VSAKDKATGKE  I I+   GLS++EI++MVK+AE HA+ D +R+   + RNQA++T Y
Sbjct:  307 VDHVVLVGGSTRMPAVSDLVKEMTGKDPNKGVNPDEVVAVGAALQAGVLRGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKKSETFTTADDNQPSVQIQVYQGEREMASANKLLGSFELGGIAPAPRGVPQIEVTFDIDANGIVSVSAKDKATGKENTIKIQDGSGLSQEEIDRMVKDAEAHAEEDKKRREEQETRNQAESTSY 517          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: HSP7M_EMENI (Heat shock 70 kDa protein OS=Emericella nidulans GN=AN6010 PE=1 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 4.397e-75
Identity = 142/210 (67.62%), Postives = 170/210 (80.95%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTI 630
            V + +LVGGMTR+PKV E V  +FG+ P+K VNPDEAVA+GAAIQG +L  +V ++LLLDVTPLSLGIETLGG+FTRLINRNTTIPTKKSQ FSTAAD QT V IKV QGERE+  DNK LG F+LVGIPPA RG+PQIEVTFDIDA+ IV V AKDK+T K+Q ITI S  GLS+ EI+ MV++AE +  +D ERKA I+  N+AD+ +
Sbjct:  368 VQDIILVGGMTRMPKVTESVKSLFGREPAKSVNPDEAVAIGAAIQGAVLAGEVTDVLLLDVTPLSLGIETLGGVFTRLINRNTTIPTKKSQTFSTAADFQTAVEIKVFQGERELVKDNKLLGNFQLVGIPPAHRGVPQIEVTFDIDADSIVHVHAKDKSTNKDQSITIASGSGLSDAEIQSMVEDAEKYGAQDKERKAAIEAANRADSVL 577          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_TETHA (Chaperone protein dnaK OS=Tetragenococcus halophilus GN=dnaK PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 4.397e-75
Identity = 138/213 (64.79%), Postives = 174/213 (81.69%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI 639
            +D+ +LVGG TR+P V E V +  GK P+K VNPDE VA+GAAIQ G++  DVK+++LLDVTPLSLGIET+GG+FT+LI+RNTTIPT KSQVFSTAADNQ  V I VLQGER MA+DNK+LG F+L  IP APRG+PQIEV+FDID NGIV VSAKD  T K  +ITI+SS GLS+DEI+KMVK+AE +A+ D +RK  +D+RN+ DT ++++
Sbjct:  305 IDQVILVGGSTRIPSVVESVRKETGKEPNKSVNPDEVVAMGAAIQAGVISGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVPQIEVSFDIDKNGIVNVSAKDLGTQKRTKITIQSSSGLSDDEIDKMVKDAEANAEADEKRKEEVDLRNEVDTLLFTV 517          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_STAHJ (Chaperone protein dnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 4.397e-75
Identity = 138/213 (64.79%), Postives = 171/213 (80.28%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI 639
            +DE +LVGG TR+P VQE V +  GK P KGVNPDE VA+GAAIQGG++  DVK+++LLDVTPLSLGIE +GG    LI RNTTIPT KSQV+STAADNQ  V I VLQGER MASDNK+LG F+L  IPPAPRG+PQIEVTFDID NGIV V+AKD  T KEQ ITI+SS  LS++EI++MVK+AE +A+ D +R+  +D+RN+AD+ ++ +
Sbjct:  304 IDEVILVGGSTRIPAVQEAVKKEIGKDPHKGVNPDEVVAMGAAIQGGVITGDVKDVVLLDVTPLSLGIEIMGGRMNTLIERNTTIPTSKSQVYSTAADNQPAVDIHVLQGERPMASDNKTLGRFQLTDIPPAPRGVPQIEVTFDIDKNGIVNVTAKDLGTNKEQNITIQSSSALSDEEIDRMVKDAEENAEADKKRREEVDLRNEADSLVFQV 516          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_PSEPF (Chaperone protein dnaK OS=Pseudomonas fluorescens (strain Pf0-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 4.397e-75
Identity = 139/212 (65.57%), Postives = 175/212 (82.55%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +D+ +LVGG TR+P VQ+ VS+ FGK   K VNPDEAVA+GAAIQG +L  DVK++LLLDV+PL+LGIET+GG+ T LI +NTTIPTKKSQVFSTA DNQ  V I VLQGER+ A+ NKSLG+F+L  IPPAPRG+PQIEVTFDIDANGI+ V AKDKATGKEQ+ITI+++ GLS++EI+KMV++AEL+A+ D + + L   RNQ D  ++S
Sbjct:  334 IDDVILVGGQTRMPMVQKAVSDFFGKEARKDVNPDEAVAMGAAIQGAVLAGDVKDVLLLDVSPLTLGIETMGGVMTALIEKNTTIPTKKSQVFSTADDNQGAVTIHVLQGERKQAAQNKSLGKFDLADIPPAPRGVPQIEVTFDIDANGILHVGAKDKATGKEQKITIKANSGLSDEEIQKMVRDAELNAEEDRKFEELAAARNQGDALVHS 545          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_HERAR (Chaperone protein dnaK OS=Herminiimonas arsenicoxydans GN=dnaK PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 4.397e-75
Identity = 141/212 (66.51%), Postives = 170/212 (80.19%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +D+ +LVGGMTR+PKVQE V E FGK P K VNPDEAVA+GAAIQG +L  D K+LLLLDVTPLSLGIETLGG+ T++I +NTTIPTK SQVFSTA DNQ  V IKV QGEREMA  NK+LGEF L GIPP+ RG PQIEVTFDIDANGI+ V AKDKATGKE +ITI+++ GL+E+EI+KMV++AE +A+ D   K + +  N  D  ++S
Sbjct:  335 IDDIILVGGMTRMPKVQEKVKEFFGKEPRKDVNPDEAVAVGAAIQGSVLSGDRKDLLLLDVTPLSLGIETLGGVMTKMIQKNTTIPTKFSQVFSTADDNQPAVTIKVFQGEREMAVGNKALGEFNLEGIPPSARGTPQIEVTFDIDANGILHVGAKDKATGKENKITIKANSGLTEEEIQKMVQDAEANAEEDKRLKEVAEAHNHGDALVHS 546          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_SHEAM3.367e-7566.04Chaperone protein dnaK OS=Shewanella amazonensis (... [more]
DNAK_RUTMC3.367e-7564.62Chaperone protein dnaK OS=Ruthia magnifica subsp. ... [more]
DNAK_LISW63.367e-7564.32Chaperone protein dnaK OS=Listeria welshimeri sero... [more]
DNAK_LACF33.367e-7564.93Chaperone protein dnaK OS=Lactobacillus fermentum ... [more]
DNAK_CORA73.367e-7566.82Chaperone protein dnaK OS=Corynebacterium aurimuco... [more]
HSP7M_EMENI4.397e-7567.62Heat shock 70 kDa protein OS=Emericella nidulans G... [more]
DNAK_TETHA4.397e-7564.79Chaperone protein dnaK OS=Tetragenococcus halophil... [more]
DNAK_STAHJ4.397e-7564.79Chaperone protein dnaK OS=Staphylococcus haemolyti... [more]
DNAK_PSEPF4.397e-7565.57Chaperone protein dnaK OS=Pseudomonas fluorescens ... [more]
DNAK_HERAR4.397e-7566.51Chaperone protein dnaK OS=Herminiimonas arsenicoxy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top