DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_EHRCJ (Chaperone protein dnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 9.818e-88
Identity = 151/212 (71.23%), Postives = 176/212 (83.02%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTRVPKV + V E FG+ P KGVNPDE VA+GAAIQG IL  DV+++LLLDVTPLSLGIETLGG+FT LI RNTTIPTKKSQVFSTA D QT V IKV QGER+MA+DNK LG+F L GIP APRGMPQIEVTFDIDANGIV VSAKDKA+GKEQ I I+SSGGLS+DEI++M+KEAE  A  D +RK  I+++N  +  ++S
Sbjct:  324 IDEVVLVGGMTRVPKVIQKVKEFFGREPHKGVNPDEVVAIGAAIQGSILAGDVRDVLLLDVTPLSLGIETLGGVFTPLIERNTTIPTKKSQVFSTAEDGQTAVTIKVYQGERKMAADNKLLGQFSLEGIPSAPRGMPQIEVTFDIDANGIVHVSAKDKASGKEQAIKIQSSGGLSDDEIQRMIKEAEQKAGEDEKRKKFIELKNNGENLVHS 535          

HSP 2 Score: 46.2098 bits (108), Expect = 9.818e-88
Identity = 24/57 (42.11%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMG---ADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL EY +KIP+    EIE+A+ D+R A+G    ++VD ++ K+D   K   K+G+
Sbjct:  537 EKSLNEYGDKIPNSDRLEIENAIRDVRDALGNSDVESVDILQQKVDHLMKVSMKLGE 593          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_WOLTR (Chaperone protein dnaK OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dnaK PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 2.179e-87
Identity = 151/212 (71.23%), Postives = 180/212 (84.91%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+P+V E V E FGK P +GVNPDE VA+GAAIQ GI++ DV+++LLLDVTPLSLGIETLGG+FT LI RNTTIPTKKSQVFSTA DNQT V IKV QGER++A DNK LG+F L GIPPAPRG+PQIEVTFDIDANGIV VSAKDKATGKEQ+I I+SSGGLSE EI +M++EAE  AQ D +RK  ++++NQAD+ ++S
Sbjct:  324 IGEVVLVGGMTRMPRVIEKVKEFFGKDPHRGVNPDEVVAIGAAIQAGIVQGDVRDVLLLDVTPLSLGIETLGGVFTPLIERNTTIPTKKSQVFSTAEDNQTAVTIKVHQGERKLAVDNKLLGQFSLEGIPPAPRGIPQIEVTFDIDANGIVHVSAKDKATGKEQKIRIQSSGGLSESEINRMIREAEEKAQEDEKRKKFVEVKNQADSLVHS 535          

HSP 2 Score: 41.5874 bits (96), Expect = 2.179e-87
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKS---KLDAANKAVSKIGQ 802
            EKSL EY +K+  E    IE+AV +L++A  +DN+DD+ S   K+   ++   K+G+
Sbjct:  537 EKSLKEYGDKVSPEDKSAIENAVNELKEASKSDNIDDVDSIQQKITNLSQLSMKLGE 593          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GLUOX (Chaperone protein dnaK OS=Gluconobacter oxydans GN=dnaK PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 2.843e-87
Identity = 146/211 (69.19%), Postives = 178/211 (84.36%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +DE +LVGGMTR+PKV E V E FGK P++ VNPDE VA+GAA+QG +L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ FSTA DNQ  V IKV QGEREMA+DNK LG F+L GI PAPRG+PQIEVTFDIDANGIV VSAKDKAT KEQQI I++SGGLS+ +I++MVK+AE +A  D  ++ L+++RN  ++ I+
Sbjct:  329 IDEVILVGGMTRMPKVIETVKEFFGKDPARNVNPDEVVAIGAAVQGAVLKGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQTFSTAEDNQNAVTIKVYQGEREMAADNKLLGNFDLQGIAPAPRGVPQIEVTFDIDANGIVNVSAKDKATNKEQQIKIQASGGLSDADIDRMVKDAEANASADKAKRELVELRNSTESLIH 539          

HSP 2 Score: 45.4394 bits (106), Expect = 2.843e-87
Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKS+ E  +K+P+    E E A+A+ R+A+G +N+D +K+  +   +A  K+GQ
Sbjct:  542 EKSITEGGDKVPAADKSEAEAAIAEAREALGGENLDTLKAASEKLTQAAMKVGQ 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_HYPNA (Chaperone protein dnaK OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaK PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.843e-87
Identity = 151/217 (69.59%), Postives = 180/217 (82.95%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EEL 651
            +DE +LVGGMTR+P VQE V + F + P KGVNPDE VA+GAAIQGG+L+ DVK+++LLDVTPLSLGIETLGGIFTRLI RNTTIPTKKSQVFSTA DNQ  V IKV QGEREMASDNK LG+F L GI PAPRG+PQIEVTFDIDANGIV+VSAKDKATGKEQQITI++ GGLSE +I+ M+ +AE +A  D  R+ L++ +N A+  I+   ++L
Sbjct:  329 IDEVVLVGGMTRMPAVQEAVKKFFNREPHKGVNPDEVVAIGAAIQGGVLQGDVKDVVLLDVTPLSLGIETLGGIFTRLIERNTTIPTKKSQVFSTAEDNQPAVTIKVAQGEREMASDNKQLGQFNLEGIAPAPRGLPQIEVTFDIDANGIVSVSAKDKATGKEQQITIQADGGLSEADIKNMMADAESNASTDKARRELVEAKNHAEALIHQTEKQL 545          

HSP 2 Score: 42.3578 bits (98), Expect = 2.843e-87
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EK L E+  K+   +  +IE A+ADL++A   DN  DI +K  A   A  K+G+
Sbjct:  542 EKQLIEHGAKVTDAIKGDIEKAIADLKEAAAGDNAADIAAKHQALMNAAMKLGE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_WOLPM (Chaperone protein dnaK OS=Wolbachia pipientis wMel GN=dnaK PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 3.708e-87
Identity = 153/212 (72.17%), Postives = 179/212 (84.43%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKV E V E FGK P +GVNPDE VA+GAAIQ GI++ DV+++LLLDVTPLSLGIETLGG+FT LI RNTTIPTKKSQVFSTA DNQT V IKV QGER++A DNK LG+F L GIPPAPRG PQIEVTFDIDANGI  VSAKDKATGKEQ+I I+SSGGLS++EI +MVKEAE  AQ D +RK  I+++NQAD+ ++S
Sbjct:  328 IGEVVLVGGMTRMPKVIEKVKEFFGKDPHRGVNPDEVVAIGAAIQAGIIQGDVRDVLLLDVTPLSLGIETLGGVFTPLIERNTTIPTKKSQVFSTAEDNQTAVTIKVHQGERKLAVDNKLLGQFSLEGIPPAPRGRPQIEVTFDIDANGIAHVSAKDKATGKEQKIRIQSSGGLSDNEINRMVKEAEEKAQEDEKRKKFIEVKNQADSLVHS 539          

HSP 2 Score: 40.4318 bits (93), Expect = 3.708e-87
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDD---IKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+  E    IE+AV +L++   +DN+DD   I+ K+   ++   K+G+ M
Sbjct:  541 EKSLTEYGDKVSPEDRSAIENAVNELKEVSKSDNIDDADSIQQKVTNLSQLSMKLGEAM 599          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GEOSF (Chaperone protein dnaK OS=Geobacter sp. (strain FRC-32) GN=dnaK PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 3.708e-87
Identity = 150/212 (70.75%), Postives = 180/212 (84.91%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+P VQ+ V +IFGK P++GVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+ TRLI +N+TIP +KSQ+FSTAADNQ  V I VLQGEREMA DNK+LG FEL GIP APRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLS++EI+KMV+EAE HA  D +++ LI+ RNQAD+ +YS
Sbjct:  329 IDEVILVGGMTRMPIVQKRVQDIFGKVPNRGVNPDEVVAIGAAIQGGVLKGDVKDVLLLDVTPLSLGIETLGGVMTRLIEKNSTIPCRKSQIFSTAADNQPAVSIHVLQGEREMAGDNKTLGNFELTGIPAAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEIDKMVREAESHASEDKKKRELIEARNQADSLVYS 540          

HSP 2 Score: 39.6614 bits (91), Expect = 3.708e-87
Identity = 27/92 (29.35%), Postives = 44/92 (47.83%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKI-------GQHMXXXXXXXXXXXXXXXXEQTPEAEYEEVKK 895
            EKSL E+ +KI +   ++IE+ +A L+KAM  ++ D IK   D   +A  K+        Q                  E+  +A++EEVK+
Sbjct:  542 EKSLSEFGDKIDAAEKQKIEEGLAALKKAMEGNDADAIKKASDELMQASHKLAEAVYAKAQPAGEEQAGAAAHEGEAKGEKVVDADFEEVKE 633          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GEOLS (Chaperone protein dnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.837e-87
Identity = 152/212 (71.70%), Postives = 177/212 (83.49%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+P V + V EIFGK P+KGVNPDE VA+GA IQGG+L+ DVK++LLLDVTPLSLGIETLGG+ TRLI +NTTIP +KSQ FSTAADNQ  V I VLQGEREMA DNK+LG FEL GIPPAPRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLS++EI+KMVK+AE HA  D +++  I+ RNQAD+ IYS
Sbjct:  329 IDEVILVGGMTRMPAVVQRVQEIFGKVPNKGVNPDEVVAIGAGIQGGVLKGDVKDVLLLDVTPLSLGIETLGGVLTRLIEKNTTIPCRKSQTFSTAADNQPAVSIHVLQGEREMARDNKTLGNFELTGIPPAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEIDKMVKDAESHAAEDKKKREAIEARNQADSMIYS 540          

HSP 2 Score: 38.891 bits (89), Expect = 4.837e-87
Identity = 20/56 (35.71%), Postives = 32/56 (57.14%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL E  +K+ +     IE+ +ADL+K M +D+ + IK   D   +A  K+ + M
Sbjct:  542 EKSLKEVGDKVDAVEKGTIENKIADLKKVMDSDDAEVIKKATDELAQAAHKLAEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_PELCD (Chaperone protein dnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 4.837e-87
Identity = 150/212 (70.75%), Postives = 179/212 (84.43%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            VDE LLVGGMTR+P VQ  V EIFGK+P+KGVNPDE VA+GAAIQGG+L+ +VK++LLLDVTPLSLGIETLG I T+LI +NTTIP KKSQ+FSTAADNQ  V + VLQGEREMA DNK++G FELVGIPPAPRG+PQ+EVTFDIDANGI+ VSAKD  TGKEQ I I +S GLS++EI+KMVK+AE H+  D +++ +I+ RNQAD   YS
Sbjct:  329 VDEVLLVGGMTRMPAVQAKVQEIFGKTPNKGVNPDEVVAIGAAIQGGVLKGEVKDVLLLDVTPLSLGIETLGSIMTKLIEKNTTIPCKKSQIFSTAADNQPAVSVHVLQGEREMAGDNKTIGRFELVGIPPAPRGVPQVEVTFDIDANGILHVSAKDLGTGKEQSIRITASSGLSDEEIDKMVKDAEAHSSEDKKKREIIEARNQADGLAYS 540          

HSP 2 Score: 38.1206 bits (87), Expect = 4.837e-87
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL E+ +KI  E    I+ A+  L+ AM  D+ +DI+ K +A   A  K+ +
Sbjct:  542 EKSLKEHGDKIDEETRNNIQTALDALKAAMEGDDPEDIRQKSEALATASHKLAE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GEOSM (Chaperone protein dnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 6.309e-87
Identity = 150/211 (71.09%), Postives = 180/211 (85.31%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +DE +LVGGMTR+P VQ+ V +IFGK P++GVNPDE VA+GAAIQGG+LR DVK++LLLDVTPLSLGIETLGG+ T+LI++N+TIP +KSQVFSTAADNQ  V I VLQGEREMA+DNK+LG FEL GIP APRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLS++E+EKMV+EAE HA  D +++ LI+ +NQAD  IY
Sbjct:  329 IDEVILVGGMTRMPIVQKKVQDIFGKVPNRGVNPDEVVAIGAAIQGGVLRGDVKDVLLLDVTPLSLGIETLGGVLTKLIDKNSTIPCRKSQVFSTAADNQPAVSIHVLQGEREMAADNKTLGNFELSGIPSAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEVEKMVREAEAHAADDKKKRELIEAKNQADNLIY 539          

HSP 2 Score: 40.817 bits (94), Expect = 6.309e-87
Identity = 20/54 (37.04%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL E+ +KI +   ++IE+ VA L+KA+   + D+IK   D+  +A  K+ +
Sbjct:  542 EKSLTEFGDKIDASEKQKIEEGVAALKKALEGSDADEIKKASDSLMQASHKLAE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GEOBB (Chaperone protein dnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 6.309e-87
Identity = 150/211 (71.09%), Postives = 180/211 (85.31%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +DE +LVGGMTR+P VQ+ V +IFGK P++GVNPDE VA+GAAIQGG+LR DVK++LLLDVTPLSLGIETLGG+ T+LI++N+TIP +KSQVFSTAADNQ  V I VLQGEREMA+DNK+LG FEL GIP APRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLS++E+EKMV+EAE HA  D +++ LI+ +NQAD  IY
Sbjct:  329 IDEVILVGGMTRMPIVQKKVQDIFGKLPNRGVNPDEVVAIGAAIQGGVLRGDVKDVLLLDVTPLSLGIETLGGVLTKLIDKNSTIPCRKSQVFSTAADNQPAVSIHVLQGEREMAADNKTLGNFELSGIPAAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEVEKMVREAEAHAADDKKKRELIEAKNQADNLIY 539          

HSP 2 Score: 40.817 bits (94), Expect = 6.309e-87
Identity = 20/54 (37.04%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL E+ +KI +   ++IE+ VA L+KA+   + D+IK   D+  +A  K+ +
Sbjct:  542 EKSLTEFGDKIDASEKQKIEEGVAALKKALEGSDADEIKKASDSLMQASHKLAE 595          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_EHRCJ9.818e-8871.23Chaperone protein dnaK OS=Ehrlichia canis (strain ... [more]
DNAK_WOLTR2.179e-8771.23Chaperone protein dnaK OS=Wolbachia sp. subsp. Bru... [more]
DNAK_GLUOX2.843e-8769.19Chaperone protein dnaK OS=Gluconobacter oxydans GN... [more]
DNAK_HYPNA2.843e-8769.59Chaperone protein dnaK OS=Hyphomonas neptunium (st... [more]
DNAK_WOLPM3.708e-8772.17Chaperone protein dnaK OS=Wolbachia pipientis wMel... [more]
DNAK_GEOSF3.708e-8770.75Chaperone protein dnaK OS=Geobacter sp. (strain FR... [more]
DNAK_GEOLS4.837e-8771.70Chaperone protein dnaK OS=Geobacter lovleyi (strai... [more]
DNAK_PELCD4.837e-8770.75Chaperone protein dnaK OS=Pelobacter carbinolicus ... [more]
DNAK_GEOSM6.309e-8771.09Chaperone protein dnaK OS=Geobacter sp. (strain M2... [more]
DNAK_GEOBB6.309e-8771.09Chaperone protein dnaK OS=Geobacter bemidjiensis (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top