DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GLUDA (Chaperone protein dnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 8.231e-87
Identity = 151/217 (69.59%), Postives = 182/217 (83.87%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EEL 651
            +DE +LVGGMTR+PKV E V + FGK P++ VNPDE VA+GAA+QG +L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ FSTA DNQ  V IKV QGEREMA+DNK LG F+L GI PAPRG+PQIEVTFDIDANGIV+VSAKDKAT KEQQI I++SGGLSE +IEKMVK+AE +A  D  +K L++ RNQA++  + + + L
Sbjct:  329 IDEVILVGGMTRMPKVIEAVKQFFGKEPARNVNPDEVVAIGAAVQGAVLKGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQTFSTAEDNQGAVTIKVFQGEREMAADNKLLGNFDLTGIAPAPRGVPQIEVTFDIDANGIVSVSAKDKATNKEQQIKIQASGGLSESDIEKMVKDAEANATADKAKKELVEARNQAESLAHQVEKSL 545          

HSP 2 Score: 37.3502 bits (85), Expect = 8.231e-87
Identity = 19/54 (35.19%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL E  +K+P+    E E A+A +R A+   +   +KS  +  ++A  KIG+
Sbjct:  542 EKSLAEAGDKVPASDKAEAEAAIAAVRTALEGSDAAALKSASETLSQAAMKIGE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_JANSC (Chaperone protein dnaK OS=Jannaschia sp. (strain CCS1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.400e-86
Identity = 149/211 (70.62%), Postives = 186/211 (88.15%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +DE +LVGGMTR+PKV + V++ FGK P KGVNPDE VA+GAAIQ G+L+ DVK+++LLDVTPLS+GIETLGG+FTRLI+RNTTIPTKKSQ+FSTA DNQ+ V ++V QGEREMA+DNK LG+F L GIPPAPRG+PQIEVTFDIDANGIV+V AKDK TGKEQQITI++SGGLS+D+IE MV+EAE +A+ D +RK L++ RNQA++ ++
Sbjct:  329 IDEVVLVGGMTRMPKVIDEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSMGIETLGGVFTRLIDRNTTIPTKKSQIFSTADDNQSAVTLRVFQGEREMAADNKILGQFNLEGIPPAPRGVPQIEVTFDIDANGIVSVGAKDKGTGKEQQITIQASGGLSDDDIEAMVREAEENAEADKDRKDLVETRNQAESLVH 539          

HSP 2 Score: 33.113 bits (74), Expect = 1.400e-86
Identity = 16/54 (29.63%), Postives = 29/54 (53.70%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            EKSL E+ EK+     + IE A+  L++ +  D+   IK  +    +A  ++G+
Sbjct:  542 EKSLEEHGEKVDPSTVEAIELALGALKETLETDDTAKIKGGIQNVTEAAMRLGE 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_DESAD (Chaperone protein dnaK OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaK PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.827e-86
Identity = 150/212 (70.75%), Postives = 179/212 (84.43%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+P VQ+ V E FGK P++ VNPDE VA+GA+IQGGIL  DVK++LLLDVTPLSLGIET+GG+FT LI RNTTIPT+KSQVF+TAADNQ  V I VLQGER MA+DN +LG FEL G+P APRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLSE++IEKMVK+AE HA+ D +++ALI+ RNQAD+ IY+
Sbjct:  328 IDEVILVGGMTRMPLVQQKVQEFFGKEPNRSVNPDEVVAMGASIQGGILAGDVKDVLLLDVTPLSLGIETMGGVFTNLIERNTTIPTRKSQVFTTAADNQPSVSIHVLQGERPMAADNMTLGRFELTGLPAAPRGVPQIEVTFDIDANGIVNVSAKDMGTGKEQSIQITASSGLSEEDIEKMVKDAESHAEDDKKKQALIEARNQADSLIYT 539          

HSP 2 Score: 37.3502 bits (85), Expect = 1.827e-86
Identity = 18/56 (32.14%), Postives = 31/56 (55.36%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL E  E + + +  +IE  + DL+K   +D+ + IK   DA  +A  K+ + +
Sbjct:  541 EKSLREVGENVDAALKSDIEAKIEDLKKVQDSDDPETIKQATDALAQASHKLAEQL 596          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_SYNAS (Chaperone protein dnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 1.827e-86
Identity = 147/213 (69.01%), Postives = 176/213 (82.63%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI 639
            +DE +LVGGMTR+P+VQ+ V EIF + P KGVNPDE VA+GAAIQGG+L  +VK++LLLDVTPLSLGIETLGG+ T+LI +NTTIPT+KSQ+FSTAADNQ  V I VLQGER MA DN++LG F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLSE EIEK+V+EAE H + D ++K L++ RN AD   Y +
Sbjct:  329 IDEVILVGGMTRMPRVQQKVKEIFDREPHKGVNPDEVVAVGAAIQGGVLGGEVKDVLLLDVTPLSLGIETLGGVMTKLIEKNTTIPTRKSQIFSTAADNQPAVSIHVLQGERSMAGDNRTLGRFDLVGIPPAPRGIPQIEVTFDIDANGIVHVSAKDLGTGKEQSIKITASSGLSETEIEKLVREAESHGEEDRKKKELVEARNSADAMAYGV 541          

HSP 2 Score: 40.4318 bits (93), Expect = 1.827e-86
Identity = 19/56 (33.93%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK++ E+ +K+ +     IEDA+A +RKA+  D+++ I+S  D    A  K+ + M
Sbjct:  542 EKNIKEFGDKVDAAEKARIEDAIAKVRKAVEGDDINAIRSAQDELTTASHKLAEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_MESSB (Chaperone protein dnaK OS=Mesorhizobium sp. (strain BNC1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.485e-86
Identity = 157/212 (74.06%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKVQE V   FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRGMPQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ EIEKMVK+AE +A+ D +R+  ++++NQA+  I+S
Sbjct:  329 IDEVVLVGGMTRMPKVQETVKNFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKGTGKEQQIRIQASGGLSDAEIEKMVKDAEANAEADKKRRETVEVKNQAEALIHS 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_ZYMMO (Chaperone protein dnaK OS=Zymomonas mobilis GN=dnaK PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 4.055e-86
Identity = 149/217 (68.66%), Postives = 183/217 (84.33%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EEL 651
            +D+ ++VGGMTR+PKV++VV E FGK P  GVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQV+STA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLSE +I+KMVK+AE  A  D  R+ L + +N  D+ +++   +L
Sbjct:  329 IDDVVMVGGMTRMPKVRQVVKEFFGKEPHTGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRMIDRNTTIPTKKSQVYSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEQQIRIQASGGLSEGDIDKMVKDAEKFAADDKHRRELAEAKNNGDSLVHTTERQL 545          

HSP 2 Score: 35.4242 bits (80), Expect = 4.055e-86
Identity = 17/54 (31.48%), Postives = 30/54 (55.56%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            E+ L E  +K+ + +  E+E AVA ++ A+  ++V  I  K  A  +   K+GQ
Sbjct:  542 ERQLTELGDKVDAALKTEVEAAVAAVKTALEGEDVAQINEKTQALGQVAMKLGQ 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_ACICJ (Chaperone protein dnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 5.289e-86
Identity = 152/211 (72.04%), Postives = 180/211 (85.31%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +DE +LVGGMTR+PKV E V   FGK P++ VNPDE VA+GAAIQG +L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ FSTA DNQT V IKV QGEREMA+DNK LG F+L GIPPAPRG+PQIEVTFDIDANGIV+VSAKDKATGKEQQI I++SGGLS+ +IE+MVK+AE +A  D  ++ L+D RN AD  ++
Sbjct:  329 IDEVILVGGMTRMPKVIETVKTFFGKEPARNVNPDEVVAIGAAIQGAVLKGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQTFSTADDNQTAVTIKVYQGEREMAADNKLLGNFDLTGIPPAPRGVPQIEVTFDIDANGIVSVSAKDKATGKEQQIRIQASGGLSDTDIERMVKDAEANAAADKAKRELVDARNHADGLVH 539          

HSP 2 Score: 31.9574 bits (71), Expect = 5.289e-86
Identity = 16/56 (28.57%), Postives = 31/56 (55.36%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L +   K+ ++   E E A+A +R A+   +++ IKS  +   +   +IG+ M
Sbjct:  542 EKTLKDNEGKVSAQDKGEAEAAIAAVRSALEGSDLEAIKSATERLTQVAMRIGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METSB (Chaperone protein dnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 5.537e-86
Identity = 156/212 (73.58%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            ++E +LVGGMTR+PKVQEVV   FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQT V I+V QGEREMA+DNK LG+F+LVGIP APRG+PQIEVTFDIDANGIV V+AKDKAT KEQQI I++SGGLSE +I+KMVK+AE+HA  D +R+ L+D RNQA+  ++S
Sbjct:  329 INEVVLVGGMTRMPKVQEVVKSFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQTAVTIRVFQGEREMAADNKLLGQFDLVGIPGAPRGVPQIEVTFDIDANGIVNVTAKDKATNKEQQIRIQASGGLSEGDIDKMVKDAEVHAAEDKKRRELVDARNQAEAMVHS 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: HSP7E_DROME (Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2)

HSP 1 Score: 309.301 bits (791), Expect = 1.997e-85
Identity = 154/211 (72.99%), Postives = 182/211 (86.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            + E LLVGGMTR+PKVQ  V E+FG+ PS+ VNPDEAVA+GAA+QGG+L  DV ++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA+D QTQV IKV QGEREMA+DNK LG F LVGIPPAPRG+PQIEV FDIDANGIV VSAKDK TGKEQQI I+SSGGLS+DEIE M+K+AE +A  D +++ LI+I NQ ++ ++
Sbjct:  380 IGEVLLVGGMTRMPKVQSTVQELFGRQPSRSVNPDEAVAVGAAVQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTRLISRNTTIPTKKSQVFSTASDGQTQVEIKVHQGEREMANDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAKDKGTGKEQQIVIQSSGGLSKDEIENMIKKAEEYATADKQKRELIEIVNQGESIVH 590          

HSP 2 Score: 28.4906 bits (62), Expect = 1.997e-85
Identity = 14/54 (25.93%), Postives = 28/54 (51.85%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            E  + E++ ++P+E  ++++  +ADLR  +      D    L+   KA S + Q
Sbjct:  593 ETKMEEFKSQLPAEECEKLKKEIADLRTLLANKETAD----LEEVRKATSSLQQ 642          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METCA (Chaperone protein dnaK OS=Methylococcus capsulatus GN=dnaK PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 1.998e-85
Identity = 149/212 (70.28%), Postives = 174/212 (82.08%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGG TR+PKVQE V EIFG+ P K VNPDEAVA+GAAIQ G+L   VK++LLLDVTPLSLGIETLGG+ T+LI +NTTIPTK +QVFSTA DNQT V I VLQGEREMA DNKSLG F+L  IP APRG+PQIEVTFDIDANGI+ VSAKDKATGK+Q I IR+S GLSEDEI++MVK+AELHA+ D     L+  RN AD  +++
Sbjct:  334 IDEVILVGGQTRMPKVQEFVKEIFGREPRKDVNPDEAVAVGAAIQAGVLGGQVKDVLLLDVTPLSLGIETLGGVMTKLIEKNTTIPTKATQVFSTAEDNQTAVTIHVLQGEREMARDNKSLGRFDLSDIPMAPRGVPQIEVTFDIDANGILNVSAKDKATGKQQSIVIRASSGLSEDEIKRMVKDAELHAEEDRRMHELVSARNHADAVVHA 545          

HSP 2 Score: 39.6614 bits (91), Expect = 1.998e-85
Identity = 20/58 (34.48%), Postives = 32/58 (55.17%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            A  K+L E  +K+  E   +IE A+ DL+ AMG DN D I+ +  A  +   K+ + +
Sbjct:  545 ATNKTLAELGDKVSGEERAKIEAALNDLKDAMGGDNKDLIEQRTSALTELSGKLAERL 602          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_GLUDA8.231e-8769.59Chaperone protein dnaK OS=Gluconacetobacter diazot... [more]
DNAK_JANSC1.400e-8670.62Chaperone protein dnaK OS=Jannaschia sp. (strain C... [more]
DNAK_DESAD1.827e-8670.75Chaperone protein dnaK OS=Desulfovibrio salexigens... [more]
DNAK_SYNAS1.827e-8669.01Chaperone protein dnaK OS=Syntrophus aciditrophicu... [more]
DNAK_MESSB2.485e-8674.06Chaperone protein dnaK OS=Mesorhizobium sp. (strai... [more]
DNAK_ZYMMO4.055e-8668.66Chaperone protein dnaK OS=Zymomonas mobilis GN=dna... [more]
DNAK_ACICJ5.289e-8672.04Chaperone protein dnaK OS=Acidiphilium cryptum (st... [more]
DNAK_METSB5.537e-8673.58Chaperone protein dnaK OS=Methylocella silvestris ... [more]
HSP7E_DROME1.997e-8572.99Heat shock 70 kDa protein cognate 5 OS=Drosophila ... [more]
DNAK_METCA1.998e-8570.28Chaperone protein dnaK OS=Methylococcus capsulatus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top