DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BORGA (Chaperone protein dnaK OS=Borrelia garinii GN=dnaK PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 2.606e-85
Identity = 146/211 (69.19%), Postives = 177/211 (83.89%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            ++E +LVGG TR+P +Q++V +IFG+ P+KGVNPDEAVA+GAAIQGGIL  + K+++LLDVTPLSLGIETLGG+ T+LI RNTTIPTKKSQVFSTAADNQT V IKVLQGEREMA+ N+ LG F L GIP APRG+PQIEV+FDIDANGIV VSAKD  TGKEQ+I I SS GLSE EI++MVK+AE HA+ D + K  I+ +N A++ IY
Sbjct:  329 INEVILVGGSTRIPAIQKIVKDIFGQDPNKGVNPDEAVAIGAAIQGGILTGETKDMVLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMAAQNRILGNFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSESEIDRMVKDAEAHAEEDKKLKENIEAKNTANSLIY 539          

HSP 2 Score: 43.5134 bits (101), Expect = 2.606e-85
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY EKI SE  + IE+ + +L++++  +++  IKS+ +   KA  KI + M
Sbjct:  542 EKSLKEYSEKISSEDKEAIENKIKELKESLDKEDISLIKSRTEELQKASYKIAEMM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BORBZ (Chaperone protein dnaK OS=Borrelia burgdorferi (strain ZS7) GN=dnaK PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 4.434e-85
Identity = 146/211 (69.19%), Postives = 177/211 (83.89%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            ++E +LVGG TR+P +Q++V +IFG+ P+KGVNPDEAVA+GAAIQGGIL  + K+++LLDVTPLSLGIETLGG+ T+LI RNTTIPTKKSQVFSTAADNQT V IKVLQGEREMA+ N+ LG F L GIP APRG+PQIEV+FDIDANGIV VSAKD  TGKEQ+I I SS GLSE EI++MVK+AE HA+ D + K  I+ +N A++ IY
Sbjct:  329 INEVILVGGSTRIPAIQKIVKDIFGQDPNKGVNPDEAVAIGAAIQGGILTGETKDMVLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMAAQNRILGNFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSESEIDRMVKDAEAHAEEDKKLKENIEAKNTANSLIY 539          

HSP 2 Score: 42.743 bits (99), Expect = 4.434e-85
Identity = 22/56 (39.29%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY EKI SE  + IE  + +L++++  +++  IKS+ +   KA  KI + M
Sbjct:  542 EKSLKEYSEKISSEDKEAIESKIKELKESLEKEDISLIKSRTEELQKASYKIAEMM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BORBU (Chaperone protein dnaK OS=Borrelia burgdorferi GN=dnaK PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 4.434e-85
Identity = 146/211 (69.19%), Postives = 177/211 (83.89%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            ++E +LVGG TR+P +Q++V +IFG+ P+KGVNPDEAVA+GAAIQGGIL  + K+++LLDVTPLSLGIETLGG+ T+LI RNTTIPTKKSQVFSTAADNQT V IKVLQGEREMA+ N+ LG F L GIP APRG+PQIEV+FDIDANGIV VSAKD  TGKEQ+I I SS GLSE EI++MVK+AE HA+ D + K  I+ +N A++ IY
Sbjct:  329 INEVILVGGSTRIPAIQKIVKDIFGQDPNKGVNPDEAVAIGAAIQGGILTGETKDMVLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMAAQNRILGNFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSESEIDRMVKDAEAHAEEDKKLKENIEAKNTANSLIY 539          

HSP 2 Score: 42.743 bits (99), Expect = 4.434e-85
Identity = 22/56 (39.29%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY EKI SE  + IE  + +L++++  +++  IKS+ +   KA  KI + M
Sbjct:  542 EKSLKEYSEKISSEDKEAIESKIKELKESLEKEDISLIKSRTEELQKASYKIAEMM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_SPHWW (Chaperone protein dnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 4.434e-85
Identity = 147/217 (67.74%), Postives = 183/217 (84.33%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EEL 651
            +DE ++VGGMTR+PKV+EVV   FGK P  GVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQ +STA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGLS+ +I+ MVK+AE  A+ D +R+A  + +N A++ I++   +L
Sbjct:  329 IDEVVMVGGMTRMPKVREVVKSYFGKEPHTGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRMIDRNTTIPTKKSQTYSTADDNQNAVTIRVFQGEREMAADNKMLGQFDLIGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEQQIKIQASGGLSDADIDGMVKDAEKFAEEDKKRRAAAEAKNNAESLIHTTERQL 545          

HSP 2 Score: 35.4242 bits (80), Expect = 4.434e-85
Identity = 17/54 (31.48%), Postives = 29/54 (53.70%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQ 802
            E+ L E+ +K+   +  EIE A+AD + A+   + D +  K  A  +   K+GQ
Sbjct:  542 ERQLQEHGDKVDGGLKSEIEAAIADAKTAVEGGDADAMTEKAQALAQVAMKLGQ 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BEII9 (Chaperone protein dnaK OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaK PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 4.687e-85
Identity = 156/212 (73.58%), Postives = 183/212 (86.32%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            VDE +LVGGMTR+PKVQE+V + FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQT V I+V QGEREMA+DNK LG+F+LVGIP APRG+PQIEVTFDIDANGIV V+AKDKAT KEQQI I++SGGLSE +I+KMVKEAE HA  D  R+ L+D +N  +  I+S
Sbjct:  329 VDEVVLVGGMTRMPKVQEIVKQFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQTAVTIRVFQGEREMAADNKLLGQFDLVGIPGAPRGVPQIEVTFDIDANGIVNVTAKDKATNKEQQIRIQASGGLSEADIDKMVKEAEQHAAEDKVRRELVDAKNHGEAIIHS 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_DESMR (Chaperone protein dnaK OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 7.544e-85
Identity = 149/212 (70.28%), Postives = 179/212 (84.43%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+P V + V E FGK P++ VNPDE VA+GAAIQGGIL  DVK++LLLDVTPLSLGIETLGG+FT+LI RNTTIPT+KSQVF+TAADNQ  V I VLQGER MA+DN +LG FEL G+PPA RG+PQIEVTFDIDANGIV VSAKD  TGKEQ I I +S GLSE +I+K++K+AE HA+ D +++ALI+IRNQADT +Y+
Sbjct:  327 IDEVVLVGGMTRMPLVSKTVQEFFGKEPNRSVNPDEVVAMGAAIQGGILAGDVKDVLLLDVTPLSLGIETLGGVFTKLIERNTTIPTRKSQVFTTAADNQPSVSIHVLQGERPMANDNMTLGRFELTGLPPAARGIPQIEVTFDIDANGIVNVSAKDTGTGKEQSIRITASSGLSEADIQKLIKDAESHAEDDKKKQALIEIRNQADTLVYT 538          

HSP 2 Score: 32.3426 bits (72), Expect = 7.544e-85
Identity = 17/56 (30.36%), Postives = 30/56 (53.57%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL E  EKI      EIE  + ++++ +  ++ D IK   D  ++A  K+ + +
Sbjct:  540 EKSLAELGEKIDGVTRGEIEAKLNNVKETLKGEDADAIKRATDDLSQASHKLAEKL 595          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BORAP (Chaperone protein dnaK OS=Borrelia afzelii (strain PKo) GN=dnaK PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 7.544e-85
Identity = 146/211 (69.19%), Postives = 177/211 (83.89%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            ++E +LVGG TR+P +Q++V +IFG+ P+KGVNPDEAVA+GAAIQGGIL  + K+++LLDVTPLSLGIETLGG+ T+LI RNTTIPTKKSQVFSTAADNQT V IKVLQGEREMA+ N+ LG F L GIP APRG+PQIEV+FDIDANGIV VSAKD  TGKEQ+I I SS GLSE EI++MVK+AE HA+ D + K  I+ +N A++ IY
Sbjct:  329 INEVILVGGSTRIPAIQKIVKDIFGQDPNKGVNPDEAVAIGAAIQGGILTGETKDMVLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMAAQNRILGNFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSESEIDRMVKDAEAHAEEDKKLKENIEAKNTANSLIY 539          

HSP 2 Score: 41.9726 bits (97), Expect = 7.544e-85
Identity = 22/56 (39.29%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY EKI  E  + IE+ + +L++++  +++  IKSK +   KA  KI + M
Sbjct:  542 EKSLKEYSEKISIEDKETIENKIKELKESLEKEDISLIKSKTEELQKASYKIAEMM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BORDL (Chaperone protein dnaK OS=Borrelia duttonii (strain Ly) GN=dnaK PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 7.544e-85
Identity = 149/211 (70.62%), Postives = 178/211 (84.36%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            ++E +LVGG TR+P +Q++V EIFG+ P+KGVNPDEAVA+GAAIQGGIL  + K+++LLDVTPLSLGIETLGG+ T+LI RNTTIPTKKSQVFSTAADNQT V IKVLQGEREMAS N+ LG F L GIP APRG+PQIEV+FDIDANGIV VSAKD  TGKEQ+I I SS GLSE+EIE+MVK+AE HA+ D + K  I+ +N A++ IY
Sbjct:  329 INEVILVGGSTRIPAIQKIVKEIFGQEPNKGVNPDEAVAIGAAIQGGILTGEAKDMVLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMASQNRVLGNFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSEEEIERMVKDAESHAEEDKKLKEGIEAKNIANSLIY 539          

HSP 2 Score: 39.2762 bits (90), Expect = 7.544e-85
Identity = 20/56 (35.71%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY EKI ++  + IE+ + +L+ A+   ++  +KSK +   +A  KI + M
Sbjct:  542 EKSLKEYGEKITNQDKEAIENKIKELKDALEGSDISLLKSKTEELQQASYKIAEMM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHORT (Chaperone protein dnaK OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=dnaK PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 7.995e-85
Identity = 153/212 (72.17%), Postives = 187/212 (88.21%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKVQ+VV + FG+ P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPT+KSQ FSTA D+QT V I+V QGEREMA+DNK LG+F+LVG+P APRG+PQIEVTFDIDANGIV VSAKDKATGKEQ I I++SGGLS+++IE+MVKEAEL+A+ D +RK  ++ RN AD  I++
Sbjct:  329 IDEVILVGGMTRMPKVQQVVKDFFGREPHKGVNPDEVVAMGAAIQGGVLKGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTRKSQTFSTAEDSQTAVTIRVFQGEREMAADNKMLGQFDLVGLPSAPRGVPQIEVTFDIDANGIVNVSAKDKATGKEQAIRIQASGGLSDNDIERMVKEAELNAEADRKRKEAVEARNHADGLIHA 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_NEOSM (Chaperone protein dnaK OS=Neorickettsia sennetsu (strain Miyayama) GN=dnaK PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 9.840e-85
Identity = 143/214 (66.82%), Postives = 176/214 (82.24%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRX--DVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            ++E +LVGGMTR+P V + V+E FGK P KGVNPDE VA+GAAIQ  IL    D ++++LLDVTPLSLGIETLGG+FT+LI+RNTTIPTK+SQ FSTA DNQ+ V I+V QGER+MASDNK LG+F L GIPPAPRGMPQIEVTFDIDANGIV VSAKDK TGKEQ + I++SGGL+E+EI+KMV EA   A  D +R+ L++ +N A++ I+S
Sbjct:  328 INEVVLVGGMTRMPAVVKKVTEFFGKEPHKGVNPDEVVAIGAAIQANILAGGSDAQDIVLLDVTPLSLGIETLGGVFTKLIDRNTTIPTKRSQTFSTAEDNQSAVTIRVFQGERQMASDNKLLGQFSLEGIPPAPRGMPQIEVTFDIDANGIVHVSAKDKGTGKEQTVKIQASGGLTEEEIKKMVDEAASKADEDKKRRELVEAKNSAESLIHS 541          

HSP 2 Score: 50.8322 bits (120), Expect = 9.840e-85
Identity = 31/89 (34.83%), Postives = 43/89 (48.31%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM-----XXXXXXXXXXXXXXXXEQTPEAEYEEVK 892
            EKSL EY  KI S   + I+DA++DL+  +  D+   IK K DA +K   K+G+ M                     E+  + EYEEVK
Sbjct:  543 EKSLSEYGSKISSSDKQSIDDAISDLKSVLAKDDASLIKEKTDALSKVSMKLGEAMYKESQSASNDPSPKNDSTEEGERVVDPEYEEVK 631          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_BORGA2.606e-8569.19Chaperone protein dnaK OS=Borrelia garinii GN=dnaK... [more]
DNAK_BORBZ4.434e-8569.19Chaperone protein dnaK OS=Borrelia burgdorferi (st... [more]
DNAK_BORBU4.434e-8569.19Chaperone protein dnaK OS=Borrelia burgdorferi GN=... [more]
DNAK_SPHWW4.434e-8567.74Chaperone protein dnaK OS=Sphingomonas wittichii (... [more]
DNAK_BEII94.687e-8573.58Chaperone protein dnaK OS=Beijerinckia indica subs... [more]
DNAK_DESMR7.544e-8570.28Chaperone protein dnaK OS=Desulfovibrio magneticus... [more]
DNAK_BORAP7.544e-8569.19Chaperone protein dnaK OS=Borrelia afzelii (strain... [more]
DNAK_BORDL7.544e-8570.62Chaperone protein dnaK OS=Borrelia duttonii (strai... [more]
DNAK_RHORT7.995e-8572.17Chaperone protein dnaK OS=Rhodospirillum rubrum (s... [more]
DNAK_NEOSM9.840e-8566.82Chaperone protein dnaK OS=Neorickettsia sennetsu (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top