DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_WOLSU (Chaperone protein dnaK OS=Wolinella succinogenes GN=dnaK PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 9.841e-85
Identity = 149/218 (68.35%), Postives = 181/218 (83.03%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EELG 654
            + E ++VGG TR+PKVQ+ V +  GK  +K VNPDE VALGAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+ T++I+R TTIP KKSQVFSTA DNQ  V I+VLQGERE+A DNKSLG FEL GIP APRG+PQIEVTFDIDANGI+TVSAKDKATGK Q+I I  S GLS+ EIEKMVK+AELH + D++RK++I+ +NQAD+ +Y   + LG
Sbjct:  328 IAEVVMVGGSTRIPKVQQRVKDFIGKELNKSVNPDEVVALGAAIQGGVLKGDVKDVLLLDVTPLSLGIETLGGVMTKIIDRGTTIPVKKSQVFSTAEDNQPAVTIQVLQGERELARDNKSLGMFELSGIPAAPRGVPQIEVTFDIDANGILTVSAKDKATGKSQEIKITGSSGLSDSEIEKMVKDAELHKEEDSKRKSMIEAKNQADSLLYQTEKSLG 545          

HSP 2 Score: 36.1946 bits (82), Expect = 9.841e-85
Identity = 17/58 (29.31%), Postives = 35/58 (60.34%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNV--DDIKSKLDAANKAVSKIGQHM 808
            EKSLGE+++++      +IE A+ DL++ +  +N+  ++I  K+ A  +   K+ + M
Sbjct:  541 EKSLGEFKDQLEESERTKIESAINDLKETLKKENLTKEEIDEKVKALTEVSHKLAEAM 598          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_SILST (Chaperone protein dnaK OS=Silicibacter sp. (strain TM1040) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.044e-84
Identity = 156/212 (73.58%), Postives = 187/212 (88.21%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKV E V++ FGK P KGVNPDE VA+GAAIQ G+L+ DVK+++LLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F L  IPPAPRGMPQIEVTFDIDANGIV+VSAKDK TGKEQ+ITI++SGGLS+++IEKMVK+AE +A+ D ER+ LI+ RNQA++ I+S
Sbjct:  330 IDEVVLVGGMTRMPKVIEEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFNLEDIPPAPRGMPQIEVTFDIDANGIVSVSAKDKGTGKEQKITIQASGGLSDEDIEKMVKDAEDNAEADKERRELIEARNQAESLIHS 541          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_DESAA (Chaperone protein dnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.044e-84
Identity = 156/212 (73.58%), Postives = 181/212 (85.38%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            VDE +LVGGMTR+P VQE V +IFGK P KGVNPDE VA+GA IQGG+L  DVK++LLLDVTPLSLGIETLGG+ T+LI +NTTIPTKKSQVFSTAADNQ  V I VLQGEREMA+ NK+LG FELVGIPPAPRG+PQIEVTFDIDANGIV+VSAKD+ TGKEQ I I +S GL+E+EIE+MVK+AELHA+ D ++K L D RN AD  +Y+
Sbjct:  329 VDEVILVGGMTRMPAVQERVKKIFGKEPHKGVNPDEVVAIGAGIQGGVLMGDVKDVLLLDVTPLSLGIETLGGVMTKLIEKNTTIPTKKSQVFSTAADNQPAVSIHVLQGEREMATGNKTLGRFELVGIPPAPRGVPQIEVTFDIDANGIVSVSAKDQGTGKEQSIKITASSGLTEEEIEQMVKDAELHAEEDKKKKELADARNNADALVYA 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_DESDA (Chaperone protein dnaK OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=dnaK PE=2 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 1.284e-84
Identity = 145/211 (68.72%), Postives = 177/211 (83.89%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +DE +LVGGMTR+P VQ+VV + FGK P++ VNPDE VA+GAAIQGGIL  DVK++LLLDVTPLSLGIET+GG+FTRLI RNTTIPT+KSQVF+TA+DNQ  V I VLQGER M++DN +L  F+L GIPPAPRG+PQIEV+FDIDANGIV VSAKD  TGKEQ I I +S GLSE++I+K+V+EAE HA  D +++ LI+ RN AD+ IY
Sbjct:  328 IDEVILVGGMTRMPLVQQVVGKFFGKEPNRSVNPDEVVAMGAAIQGGILSGDVKDVLLLDVTPLSLGIETMGGVFTRLIERNTTIPTRKSQVFTTASDNQPSVSIHVLQGERPMSADNMTLARFDLAGIPPAPRGVPQIEVSFDIDANGIVNVSAKDMGTGKEQSIKITASSGLSEEDIQKLVREAEAHATDDKKKQELIEARNHADSLIY 538          

HSP 2 Score: 38.1206 bits (87), Expect = 1.284e-84
Identity = 20/56 (35.71%), Postives = 31/56 (55.36%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL +  +K  + V  +IE  +ADLRK M  ++   IK+  D   KA  K+ + +
Sbjct:  541 EKSLADLGDKADAAVKSDIETKMADLRKLMEGEDAAAIKTATDELAKASHKLAEQL 596          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_EHRSE (Chaperone protein dnaK OS=Ehrlichia sennetsu GN=dnaK PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.284e-84
Identity = 143/214 (66.82%), Postives = 176/214 (82.24%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRX--DVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            ++E +LVGGMTR+P V + V+E FGK P KGVNPDE VA+GAAIQ  IL    D ++++LLDVTPLSLGIETLGG+FT+LI+RNTTIPTK+SQ FSTA DNQ+ V I+V QGER+MASDNK LG+F L GIPPAPRGMPQIEVTFDIDANGIV VSAKDK TGKEQ + I++SGGL+E+EI+KMV EA   A  D +R+ L++ +N A++ I+S
Sbjct:  328 INEVVLVGGMTRMPAVVKKVTEFFGKEPHKGVNPDEVVAIGAAIQANILAGGSDAQDIVLLDVTPLSLGIETLGGVFTKLIDRNTTIPTKRSQTFSTAEDNQSAVTIRVFQGERQMASDNKLLGQFSLGGIPPAPRGMPQIEVTFDIDANGIVHVSAKDKGTGKEQTVKIQASGGLTEEEIKKMVDEAASKADEDKKRRELVEAKNSAESLIHS 541          

HSP 2 Score: 50.8322 bits (120), Expect = 1.284e-84
Identity = 31/89 (34.83%), Postives = 43/89 (48.31%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM-----XXXXXXXXXXXXXXXXEQTPEAEYEEVK 892
            EKSL EY  KI S   + I+DA++DL+  +  D+   IK K DA +K   K+G+ M                     E+  + EYEEVK
Sbjct:  543 EKSLSEYGSKISSSDKQSIDDAISDLKSVLAKDDASLIKEKTDALSKVSMKLGEAMYKESQSASNDSSPKNDSTEEGERVVDPEYEEVK 631          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_AZOC5 (Chaperone protein dnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.364e-84
Identity = 154/212 (72.64%), Postives = 184/212 (86.79%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKVQE+V + FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA D QT V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKEQQI I++SGGL++ +IEKMVK+AE HA  D +R+AL + +N  +  ++S
Sbjct:  329 IDEVVLVGGMTRMPKVQEMVKQFFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDGQTAVTIRVFQGEREMAADNKILGQFDLVGIPPAPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLNDADIEKMVKDAESHAADDKKRRALAEAKNHGEALVHS 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METNO (Chaperone protein dnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.781e-84
Identity = 151/212 (71.23%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+Q+VV   FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV V+AKDKATGKE QI I++SGGLSE EI++MV+EAE +A  D +R+ L++++NQ ++ I++
Sbjct:  329 IDEVVLVGGMTRMPKIQDVVKTFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVTAKDKATGKEHQIRIQASGGLSETEIQRMVQEAEANAAEDKKRRELVEVKNQGESLIHA 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BORRA (Chaperone protein dnaK OS=Borrelia recurrentis (strain A1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 2.184e-84
Identity = 149/211 (70.62%), Postives = 178/211 (84.36%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            ++E +LVGG TR+P +Q++V EIFG+ P+KGVNPDEAVA+GAAIQGGIL  + K+++LLDVTPLSLGIETLGG+ T+LI RNTTIPTKKSQVFSTAADNQT V IKVLQGEREMAS N+ LG F L GIP APRG+PQIEV+FDIDANGIV VSAKD  TGKEQ+I I SS GLSE+EIE+MVK+AE HA+ D + K  I+ +N A++ IY
Sbjct:  329 INEVILVGGSTRIPAIQKIVKEIFGQEPNKGVNPDEAVAIGAAIQGGILTGEAKDMVLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMASQNRVLGNFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSEEEIERMVKDAESHAEEDKKLKEGIEAKNIANSLIY 539          

HSP 2 Score: 37.7354 bits (86), Expect = 2.184e-84
Identity = 19/56 (33.93%), Postives = 33/56 (58.93%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY EKI ++  + IE+ + +L+  +   ++  +KSK +   +A  KI + M
Sbjct:  542 EKSLKEYGEKITNQDKEAIENKIKELKDTLEGSDISLLKSKTEELQQASYKIAEMM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: GRP75_CHICK (Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 2.326e-84
Identity = 157/211 (74.41%), Postives = 182/211 (86.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            + E +LVGGMTR+PKVQ+ V ++FG++PSK VNPDEAVA+GAAIQGG+L  DV ++LLLDVTPLSLGIETLGG+FT+LINRNTTIPTKKSQVFSTAAD QTQV IKV QGEREMASDNK LG+F LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TG+EQQI I+SSGGLS+DEIE MVK AE +A+ D  RK  ++  N A+  I+
Sbjct:  382 IGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMASDNKLLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDEIENMVKNAEKYAEEDRRRKERVEAVNLAEGIIH 592          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_PARDP (Chaperone protein dnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 2.326e-84
Identity = 153/212 (72.17%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PKV E V+  FGK P KGVNPDE VALGAAIQ G+L+ DVK+++LLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ+FSTA DNQ  V I+V QGEREMA+DNK LG+F L  IPPAPRGMPQIEVTFDIDANGIV+VSAKDK TGKEQ+ITI++SGGLS+DEI++MVK+AE +A+ D +RK L++ +NQA++ I++
Sbjct:  330 IDEIVLVGGMTRMPKVVEEVTAFFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVVLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQIFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFNLENIPPAPRGMPQIEVTFDIDANGIVSVSAKDKGTGKEQKITIQASGGLSDDEIDRMVKDAEANAEADKQRKELVEAKNQAESLIHT 541          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_WOLSU9.841e-8568.35Chaperone protein dnaK OS=Wolinella succinogenes G... [more]
DNAK_SILST1.044e-8473.58Chaperone protein dnaK OS=Silicibacter sp. (strain... [more]
DNAK_DESAA1.044e-8473.58Chaperone protein dnaK OS=Desulfatibacillum alkeni... [more]
DNAK_DESDA1.284e-8468.72Chaperone protein dnaK OS=Desulfovibrio desulfuric... [more]
DNAK_EHRSE1.284e-8466.82Chaperone protein dnaK OS=Ehrlichia sennetsu GN=dn... [more]
DNAK_AZOC51.364e-8472.64Chaperone protein dnaK OS=Azorhizobium caulinodans... [more]
DNAK_METNO1.781e-8471.23Chaperone protein dnaK OS=Methylobacterium nodulan... [more]
DNAK_BORRA2.184e-8470.62Chaperone protein dnaK OS=Borrelia recurrentis (st... [more]
GRP75_CHICK2.326e-8474.41Stress-70 protein, mitochondrial OS=Gallus gallus ... [more]
DNAK_PARDP2.326e-8472.17Chaperone protein dnaK OS=Paracoccus denitrificans... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top