DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_THEYD (Chaperone protein dnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 5.182e-84
Identity = 153/213 (71.83%), Postives = 181/213 (84.98%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI 639
            +DE +LVGG TR PKVQ+VV + FGK P KGVNPDE VA+GAAIQ  IL+ +VKE+LLLDVTPLSLGIETLGG+FT++I RNTTIPTKKSQ+F+TAADNQT V IKV QGEREMA+DNK LG FELVGIPPAPRG+PQIEVTFDIDANGI+ VSAKD ATGKEQ I I +S GLSE+EI+KM++EAE HA+ D  +K + + RN+AD  IY++
Sbjct:  329 IDEVILVGGQTRTPKVQKVVQDFFGKEPHKGVNPDEVVAVGAAIQAAILKGEVKEVLLLDVTPLSLGIETLGGVFTKIIERNTTIPTKKSQIFTTAADNQTAVTIKVYQGEREMAADNKLLGVFELVGIPPAPRGIPQIEVTFDIDANGILHVSAKDLATGKEQSIRITASSGLSEEEIKKMIREAEAHAEEDRRKKQIAEARNEADNMIYTV 541          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_METS4 (Chaperone protein dnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 5.182e-84
Identity = 149/212 (70.28%), Postives = 186/212 (87.74%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+Q+VV   FGK P KGVNPDE VA+GAA+Q G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV V+AKDKATGKE QI I++SGGLS+ EI++MV+EAE +A  D +R+ L++++NQ ++ +++
Sbjct:  329 IDEVVLVGGMTRMPKIQDVVKTFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVTAKDKATGKEHQIRIQASGGLSDTEIQRMVQEAEANAAEDKKRRELVEVKNQGESLVHA 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_MARMM (Chaperone protein dnaK OS=Maricaulis maris (strain MCS10) GN=dnaK PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 5.182e-84
Identity = 154/217 (70.97%), Postives = 186/217 (85.71%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EEL 651
            +D+ +LVGGMTR+PKVQE V   FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQ FSTA DNQT V I+V QGEREMA+DNK LG+F+LVGIPP+PRG+PQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLS+D+IE+MVK+AE +A  D ++K L++  N A+  I+   ++L
Sbjct:  329 IDDIVLVGGMTRMPKVQEAVKGFFGKDPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQTFSTADDNQTAVTIRVSQGEREMAADNKLLGQFDLVGIPPSPRGLPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDDDIEQMVKDAEANADADKKKKELVEAHNGAEAMIHQTEKQL 545          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_GRABC (Chaperone protein dnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 5.182e-84
Identity = 150/217 (69.12%), Postives = 189/217 (87.10%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EEL 651
            + + +LVGGMTR+PKV E V + FGK P++ VNPDE VA+GAA+QG +L+ DVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V IKV QGEREMA+DNKSLG+F+L G+PPAPRG+PQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLS+ +I++MV+EAE +A+ D +R+AL++ RNQA++ ++ + + L
Sbjct:  329 ISDVILVGGMTRMPKVIEAVKQFFGKEPARNVNPDEVVAIGAAVQGAVLKGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQPAVTIKVYQGEREMAADNKSLGQFDLTGLPPAPRGVPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDADIQRMVQEAEANAEADKQRRALVEARNQAESLVHQVEKNL 545          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_SILPO (Chaperone protein dnaK OS=Silicibacter pomeroyi GN=dnaK PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 8.839e-84
Identity = 155/212 (73.11%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            VDE +LVGGMTR+PKV E V++ FGK P KGVNPDE VA+GAAIQ G+L+ DVK+++LLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F L  IPPAPRGMPQIEVTFDIDANGIV+VSAKDK TGKE +ITI++SGGLS+++IEKMVK+AE +A+ D  RK L++ RNQA++ I+S
Sbjct:  329 VDEVVLVGGMTRMPKVFEEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFNLEDIPPAPRGMPQIEVTFDIDANGIVSVSAKDKGTGKEHKITIQASGGLSDEDIEKMVKDAEENAEADKARKELVEARNQAESLIHS 540          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RICRS (Chaperone protein dnaK OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaK PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.508e-83
Identity = 154/212 (72.64%), Postives = 182/212 (85.85%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQE V + FG+ P KGVNPDE VALGAAIQGG+L  +V ++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA DNK LG+F L GIPPAPRG+PQIEVTFDIDANGIV VSAKDKA+GKEQ++TI++SGGLS+ EIE+MVK+AE +A  D +RK LI+ +N AD+ +YS
Sbjct:  328 IQEVVLVGGMTRMPKVQEAVKKFFGREPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPPAPRGLPQIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDAEIEQMVKDAEQNADEDKKRKELIEAKNAADSLVYS 539          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RICRO (Chaperone protein dnaK OS=Rickettsia rickettsii (strain Iowa) GN=dnaK PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.508e-83
Identity = 154/212 (72.64%), Postives = 182/212 (85.85%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQE V + FG+ P KGVNPDE VALGAAIQGG+L  +V ++LLLDVTPLSLGIETLGG+FTRLI+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA DNK LG+F L GIPPAPRG+PQIEVTFDIDANGIV VSAKDKA+GKEQ++TI++SGGLS+ EIE+MVK+AE +A  D +RK LI+ +N AD+ +YS
Sbjct:  328 IQEVVLVGGMTRMPKVQEAVKKFFGREPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPPAPRGLPQIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDAEIEQMVKDAEQNADEDKKRKELIEAKNAADSLVYS 539          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_CHLTB (Chaperone protein dnaK OS=Chlamydia trachomatis (strain L2b/UCH-1/proctitis) GN=dnaK PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.830e-83
Identity = 141/211 (66.82%), Postives = 173/211 (81.99%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +D+ LLVGGM+R+P VQ VV EIFGK P+KGVNPDE VA+GAAIQGG+L  +VK++LLLDV PLSLGIETLGG+ T L+ RNTTIPT+K Q+FSTAADNQ  V I VLQGER MA DNK +G F+L  IPPAPRG PQIEVTFDIDANGI+ VSAKD A+G+EQ+I I +S GL EDEI++M+++AELH + D +RK   D++N+AD  I+
Sbjct:  332 IDDVLLVGGMSRMPAVQAVVKEIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEDEIQQMIRDAELHKEEDKQRKEASDVKNEADGMIF 542          

HSP 2 Score: 41.5874 bits (96), Expect = 1.830e-83
Identity = 21/57 (36.84%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGAD-NVDDIKSKLDAANKAVSKIGQHM 808
            EK++ +Y +KIP+E+ KEIE+ +  +R+A+  D +   IK+  D  +  + KIG+ M
Sbjct:  545 EKAVKDYHDKIPAELVKEIEEHIEKVRQAIKEDASTTAIKAASDELSTRMQKIGEAM 601          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_CHLTA (Chaperone protein dnaK OS=Chlamydia trachomatis (strain A/HAR-13 / ATCC VR-571B) GN=dnaK PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.830e-83
Identity = 141/211 (66.82%), Postives = 173/211 (81.99%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +D+ LLVGGM+R+P VQ VV EIFGK P+KGVNPDE VA+GAAIQGG+L  +VK++LLLDV PLSLGIETLGG+ T L+ RNTTIPT+K Q+FSTAADNQ  V I VLQGER MA DNK +G F+L  IPPAPRG PQIEVTFDIDANGI+ VSAKD A+G+EQ+I I +S GL EDEI++M+++AELH + D +RK   D++N+AD  I+
Sbjct:  332 IDDVLLVGGMSRMPAVQAVVKEIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEDEIQQMIRDAELHKEEDKQRKEASDVKNEADGMIF 542          

HSP 2 Score: 41.5874 bits (96), Expect = 1.830e-83
Identity = 21/57 (36.84%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGAD-NVDDIKSKLDAANKAVSKIGQHM 808
            EK++ +Y +KIP+E+ KEIE+ +  +R+A+  D +   IK+  D  +  + KIG+ M
Sbjct:  545 EKAVKDYHDKIPAELVKEIEEHIEKVRQAIKEDASTTAIKAASDELSTRMQKIGEAM 601          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_CHLT2 (Chaperone protein dnaK OS=Chlamydia trachomatis (strain L2/434/Bu / ATCC VR-902B) GN=dnaK PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.830e-83
Identity = 141/211 (66.82%), Postives = 173/211 (81.99%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIY 633
            +D+ LLVGGM+R+P VQ VV EIFGK P+KGVNPDE VA+GAAIQGG+L  +VK++LLLDV PLSLGIETLGG+ T L+ RNTTIPT+K Q+FSTAADNQ  V I VLQGER MA DNK +G F+L  IPPAPRG PQIEVTFDIDANGI+ VSAKD A+G+EQ+I I +S GL EDEI++M+++AELH + D +RK   D++N+AD  I+
Sbjct:  332 IDDVLLVGGMSRMPAVQAVVKEIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEDEIQQMIRDAELHKEEDKQRKEASDVKNEADGMIF 542          

HSP 2 Score: 41.5874 bits (96), Expect = 1.830e-83
Identity = 21/57 (36.84%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGAD-NVDDIKSKLDAANKAVSKIGQHM 808
            EK++ +Y +KIP+E+ KEIE+ +  +R+A+  D +   IK+  D  +  + KIG+ M
Sbjct:  545 EKAVKDYHDKIPAELVKEIEEHIEKVRQAIKEDASTTAIKAASDELSTRMQKIGEAM 601          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_THEYD5.182e-8471.83Chaperone protein dnaK OS=Thermodesulfovibrio yell... [more]
DNAK_METS45.182e-8470.28Chaperone protein dnaK OS=Methylobacterium sp. (st... [more]
DNAK_MARMM5.182e-8470.97Chaperone protein dnaK OS=Maricaulis maris (strain... [more]
DNAK_GRABC5.182e-8469.12Chaperone protein dnaK OS=Granulibacter bethesdens... [more]
DNAK_SILPO8.839e-8473.11Chaperone protein dnaK OS=Silicibacter pomeroyi GN... [more]
DNAK_RICRS1.508e-8372.64Chaperone protein dnaK OS=Rickettsia rickettsii (s... [more]
DNAK_RICRO1.508e-8372.64Chaperone protein dnaK OS=Rickettsia rickettsii (s... [more]
DNAK_CHLTB1.830e-8366.82Chaperone protein dnaK OS=Chlamydia trachomatis (s... [more]
DNAK_CHLTA1.830e-8366.82Chaperone protein dnaK OS=Chlamydia trachomatis (s... [more]
DNAK_CHLT21.830e-8366.82Chaperone protein dnaK OS=Chlamydia trachomatis (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top