DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRKO (50S ribosomal protein L3P OS=Pyrococcus kodakaraensis GN=rpl3p PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.609e-21
Identity = 46/119 (38.66%), Postives = 72/119 (60.50%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            R +  +G WHPARV +TV +AGQ G+HHRTE NK++  +G+      +     D  E +ITP GGFPHYG+V  D+L+I+G   G  KR++ +R ++     +  +E  ++ ++   SK
Sbjct:  233 RHIGNLGPWHPARVMWTVPQAGQMGFHHRTEFNKRLIAIGE------NGKLVLDGNEIEITPKGGFPHYGIVRSDFLMIEGTIPGSFKRIIRVRPAIRPPKKKPPVERPQITYVSRESK 345          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_THEGJ (50S ribosomal protein L3P OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.298e-20
Identity = 45/119 (37.82%), Postives = 72/119 (60.50%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            R +  +G WHPARV +TV +AGQ G+HHRTE NK++  +G+      +     +  E DITP GGFPHYG++  D+L+I+G   G  KR++ +R ++     +  +E  ++ ++   SK
Sbjct:  233 RHIGNLGPWHPARVMWTVPQAGQMGFHHRTEFNKRLIAIGE------NGKLVLNGNEIDITPKGGFPHYGIIRSDFLMIEGSVPGSFKRIIRVRPAIKPPKKKPPVERPQITYVSRESK 345          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_THEON (50S ribosomal protein L3P OS=Thermococcus onnurineus (strain NA1) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.214e-20
Identity = 45/119 (37.82%), Postives = 73/119 (61.34%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            R V  +G WHP RV +TV +AGQ G+HHRTE NK++  +G+     +  +   ++ E +ITP GGFPHYG++  D+L+I+G   G  KR++ +R ++     +  +E  ++ +I   SK
Sbjct:  233 RHVGNLGPWHPTRVMWTVPQAGQMGFHHRTEFNKRLIAIGE-----NGKLKLDEKNEIEITPKGGFPHYGIIRSDFLMIQGTIPGSFKRIIRVRPAIRPPKKKPPVERPQITYISRESK 346          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METS3 (50S ribosomal protein L3P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.706e-18
Identity = 52/121 (42.98%), Postives = 65/121 (53.72%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R V  IG W P+R  +TVA+AGQ GYH RTE NKKI K+  A +               I P GGF  YG+V  DY+L+KG   GP KR+V LRQ +        + +I   +I T SK G
Sbjct:  229 RHVGSIGPWTPSRTMWTVAQAGQMGYHKRTEFNKKILKIASADEVD------------QINPDGGFVKYGLVKNDYVLVKGSLPGPSKRLVILRQPIRPNNKSEDMPQI--NYISTKSKQG 335          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METAC (50S ribosomal protein L3P OS=Methanosarcina acetivorans GN=rpl3p PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.617e-18
Identity = 50/122 (40.98%), Postives = 71/122 (58.20%), Query Frame = 3
Query:   30 LRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            LR+V  +GA++P+RVS+ V + GQ GYH RTE NK+I K+G   +E              +TP GGF +YG+V  DY+LIKG   GP KR++ LR  +  +  +  L E  + +I   SK G
Sbjct:  232 LRQVGTLGAFNPSRVSWRVPQMGQMGYHQRTEFNKRILKIGSDGEE--------------VTPEGGFINYGLVRGDYILIKGSVPGPSKRLIRLRDPI--RAKKADLGEPNILYISRESKQG 337          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METJA (50S ribosomal protein L3P OS=Methanocaldococcus jannaschii GN=rpl3p PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.029e-18
Identity = 49/121 (40.50%), Postives = 67/121 (55.37%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R V  IG W P  V ++V   GQ GYH RTE NK+I K+G    E              ITP GGF HYGV+  +Y+++KG   GP KR++ LR+++  Q   + + EI   +I T+SK G
Sbjct:  230 RHVGSIGPWQPKMVMWSVPMPGQMGYHQRTEYNKRILKIGNNGDE--------------ITPKGGFLHYGVIRNNYVVLKGSVQGPAKRLIVLRRAIRPQEPLIKVPEI--TYISTTSKQG 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_META3 (50S ribosomal protein L3P OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.029e-18
Identity = 49/122 (40.16%), Postives = 67/122 (54.92%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGH 398
            R    IG W P R+ +TV  AGQ G+H RTE NK+I K+G+   E              I P GGF +YGVV  +Y+L+KG   GP KR+V LR+++     +  L E  L ++ T SK G+
Sbjct:  228 RHTGSIGPWTPKRIMWTVPMAGQVGFHQRTEYNKRILKIGENGSE--------------IVPKGGFLNYGVVKNNYVLVKGSVQGPAKRMVVLREAIRNPEDKFGLPE--LTYVSTESKQGN 333          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METTP (50S ribosomal protein L3P OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.343e-17
Identity = 49/122 (40.16%), Postives = 69/122 (56.56%), Query Frame = 3
Query:   30 LRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            LR V  +G WHPAR+S+ V + GQ GYH RTE NK+I  +G                  DITP GGF  YGVV  +Y+LIKG   GP KR+V +R++ ++  +  A +  ++ ++   SK G
Sbjct:  228 LRHVGNLGPWHPARISWRVPQLGQTGYHQRTEFNKRIMAIG--------------TNGTDITPDGGFVGYGVVRNEYMLIKGSVPGPVKRLVRMRRA-IRPGAAFAPKAPQILYVSKESKQG 334          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_UNCMA (50S ribosomal protein L3P OS=Uncultured methanogenic archaeon RC-I GN=rpl3p PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.754e-17
Identity = 44/121 (36.36%), Postives = 69/121 (57.02%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R V  +G W+P R+ + V + GQ GYH RTE NK+I K+G  ++E              ITP GGF HYG++  DY+++KG   GP KR+V +R ++  +   +  +  ++ ++ T SK G
Sbjct:  233 RHVGNLGPWNPHRIRWQVPQLGQTGYHQRTEYNKRILKMGDKAEE--------------ITPAGGFLHYGLIRNDYIMLKGSIPGPVKRMVRIRPAV--RPKNMPKQAPEITYLSTQSKMG 337          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METTH (50S ribosomal protein L3P OS=Methanobacterium thermoautotrophicum GN=rpl3p PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.754e-17
Identity = 48/121 (39.67%), Postives = 70/121 (57.85%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R +  +G W P+R  +TV +AGQ GYH RTE NK+I K+G AS+               + P GGF  YG+V  DY++IKG   GP KR+V LR+++  + +    E  ++ +I T+SK G
Sbjct:  230 RHIGSLGPWTPSRTMWTVPQAGQMGYHRRTEYNKQILKIGDASEADL------------VNPDGGFVRYGLVRNDYVMIKGSVPGPTKRLVVLRKAI--RAAGKQEEAPQINYISTASKQG 336          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3_PYRKO7.609e-2138.6650S ribosomal protein L3P OS=Pyrococcus kodakaraen... [more]
RL3_THEGJ1.298e-2037.8250S ribosomal protein L3P OS=Thermococcus gammatol... [more]
RL3_THEON2.214e-2037.8250S ribosomal protein L3P OS=Thermococcus onnurine... [more]
RL3_METS32.706e-1842.9850S ribosomal protein L3P OS=Methanobrevibacter sm... [more]
RL3_METAC4.617e-1840.9850S ribosomal protein L3P OS=Methanosarcina acetiv... [more]
RL3_METJA6.029e-1840.5050S ribosomal protein L3P OS=Methanocaldococcus ja... [more]
RL3_META36.029e-1840.1650S ribosomal protein L3P OS=Methanococcus aeolicu... [more]
RL3_METTP1.343e-1740.1650S ribosomal protein L3P OS=Methanosaeta thermoph... [more]
RL3_UNCMA1.754e-1736.3650S ribosomal protein L3P OS=Uncultured methanogen... [more]
RL3_METTH1.754e-1739.6750S ribosomal protein L3P OS=Methanobacterium ther... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top