DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METKA (50S ribosomal protein L3P OS=Methanopyrus kandleri GN=rpl3p PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.642e-15
Identity = 46/106 (43.40%), Postives = 62/106 (58.49%), Query Frame = 3
Query:   12 RKTHRGL--RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSL 323
            RKT R    R +  IG   P+RV +TV  AGQ GYH RTE NK+I K+G+  +E              +TP GGF +YGVV  DY++I G   GPKKR++ +R ++
Sbjct:  227 RKTQRKQKGRHIGSIGPITPSRVRWTVPMAGQVGYHQRTEHNKRILKIGEDGEE--------------VTPRGGFVNYGVVRGDYIMIHGTVPGPKKRLIRVRPAV 318          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METBF (50S ribosomal protein L3P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.144e-15
Identity = 47/122 (38.52%), Postives = 66/122 (54.10%), Query Frame = 3
Query:   30 LRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            LR++  +G +   RVS+ V + GQ GYH RTE NK+I K+G   +E              +TP GGF +YG+V  DY+LIKG   GP KR++ LR  +  +  +  L E  +  I   SK G
Sbjct:  232 LRQIGTLGGFGLRRVSWRVPQMGQTGYHQRTEFNKRILKIGSDGEE--------------VTPEGGFINYGLVRGDYVLIKGSVPGPSKRLIRLRDPI--RAKKADLGEPNILHISRESKQG 337          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METMJ (50S ribosomal protein L3P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.801e-15
Identity = 45/106 (42.45%), Postives = 58/106 (54.72%), Query Frame = 3
Query:   12 RKTHRGLRK--VACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSL 323
            RK  RG +K  +  +G WHP  V + V + GQ GY  RTE NK+I K+G    E              ITP GGF HYG+V   Y+LIKG   GP KR+V +R ++
Sbjct:  224 RKHSRGGKKRHIGNLGPWHPHHVRWQVPQMGQMGYQQRTEFNKRILKIGADGDE--------------ITPAGGFLHYGLVRGPYVLIKGSVPGPNKRLVRIRSAI 315          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METPE (50S ribosomal protein L3P OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.777e-15
Identity = 47/130 (36.15%), Postives = 69/130 (53.08%), Query Frame = 3
Query:   12 RKTHRGLRK--VACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            RK  RG +K  +  +G W+P  V + V + GQ GY  RT+ NK+I K+G+                 DITP GGF HYG++   Y++IKG   GP KR++ +R ++ K      +  I  +F+ T SK G
Sbjct:  224 RKHSRGGKKRHIGNLGPWNPHHVRWQVPQMGQMGYQQRTDFNKRILKIGENGT--------------DITPAGGFLHYGLLRNPYVMIKGSVPGPVKRLIRIRPAVRKGEHHARVPAI--EFVSTQSKQG 337          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PICTO (50S ribosomal protein L3P OS=Picrophilus torridus GN=rpl3p PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.064e-14
Identity = 48/132 (36.36%), Postives = 69/132 (52.27%), Query Frame = 3
Query:    6 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTE--KDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            LPRK  +  R +  +G WHP  V  TV +AGQ G+H RT  N +I K              FD  +   DI   GGF +YG+V  DY+L+ G   GP KR++ +R     + +R A+E I++ ++   SK G
Sbjct:  213 LPRKNRKHRRMIGTLGPWHPDWVRNTVPQAGQVGFHQRTIHNIRIIK--------------FDTKDHVDDINVKGGFLNYGIVRNDYVLLFGSVPGPAKRLIKMRDP--ARQTRPAVESIEVTYVSRESKQG 328          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_THEVO (50S ribosomal protein L3P OS=Thermoplasma volcanium GN=rpl3p PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.815e-14
Identity = 45/130 (34.62%), Postives = 63/130 (48.46%), Query Frame = 3
Query:    6 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            LPRK  +  R +  +G WHP  V  TV +AGQ GY  RT  N ++ K  K                  I   GGF HYG+V  DY+L+ G   GP KR++ +R    ++     ++ +KL +I   SK G
Sbjct:  215 LPRKNRKHRRMIGTLGPWHPDWVRNTVPQAGQMGYQQRTISNVRVLKYSKGEDAD------------TINVRGGFLHYGLVKNDYVLLFGSVPGPAKRLIKMRDPARQKVP--DIDNVKLDYISLESKQG 330          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METHJ (50S ribosomal protein L3P OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.815e-14
Identity = 50/130 (38.46%), Postives = 65/130 (50.00%), Query Frame = 3
Query:   12 RKTHRGL--RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            RK  RG   R V  +G W P  V + V   GQ GYH RTE NK++ K+G+   E              ITP GGF +YG V   Y+LIKG   GP KR+V +R ++  +     + E  + FI   SK G
Sbjct:  224 RKHSRGKKERHVGTLGPWTPHHVRWQVPMMGQMGYHQRTEFNKRLLKIGEDGAE--------------ITPEGGFINYGEVRARYVLIKGSVPGPSKRLVRIRHAM--RLGEHKIREPTIGFISLESKQG 337          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_THEAC (50S ribosomal protein L3P OS=Thermoplasma acidophilum GN=rpl3p PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.371e-14
Identity = 45/130 (34.62%), Postives = 64/130 (49.23%), Query Frame = 3
Query:    6 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            LPRK  +  R +  +G WHP  V  TV +AGQ G+  RT  N ++ K G   +               I   GGF HYG V  DY+L+ G   G  KR++ +R    ++     +EE+KL++I   SK G
Sbjct:  215 LPRKNRKHRRMIGTLGPWHPDWVRNTVPQAGQMGFQQRTISNVRVIKYGNKEEVD------------SINVRGGFLHYGFVKNDYVLLFGSIPGASKRLIKMRDPARQKVP--DIEEVKLEYISLESKQG 330          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRAE (50S ribosomal protein L3P OS=Pyrobaculum aerophilum GN=rpl3p PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.097e-14
Identity = 47/105 (44.76%), Postives = 58/105 (55.24%), Query Frame = 3
Query:    6 LPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLR 314
            LPR  K  +G R+   IG   PA V FT  R GQ G+H RTE NK++ K+G+   E              ITP  GFPHYGVV   Y+LI+G   G +KR+V LR
Sbjct:  224 LPRWHKHRKGHRRTGTIGPQAPA-VMFTQPRPGQMGFHQRTEYNKRLLKIGENGAE--------------ITPKSGFPHYGVVKGPYILIQGSVPGARKRLVVLR 313          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METB6 (50S ribosomal protein L3P OS=Methanoregula boonei (strain 6A8) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.044e-14
Identity = 42/121 (34.71%), Postives = 64/121 (52.89%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R V  +G W+P  V + V ++GQ GY  RTE NK+I K+G+   E              ITP GGF +YGV+   Y++IKG   GP KR++ +R ++  +     +    ++F+   SK G
Sbjct:  233 RHVGTLGPWNPHHVRWEVPQSGQMGYQQRTEFNKRILKIGENGAE--------------ITPAGGFLNYGVIRNAYVVIKGSIPGPAKRLIRIRPAI--RQGEHVVRSPAIQFVSVQSKQG 337          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3_METKA1.642e-1543.4050S ribosomal protein L3P OS=Methanopyrus kandleri... [more]
RL3_METBF2.144e-1538.5250S ribosomal protein L3P OS=Methanosarcina barker... [more]
RL3_METMJ2.801e-1542.4550S ribosomal protein L3P OS=Methanoculleus marisn... [more]
RL3_METPE4.777e-1536.1550S ribosomal protein L3P OS=Methanosphaerula palu... [more]
RL3_PICTO1.064e-1436.3650S ribosomal protein L3P OS=Picrophilus torridus ... [more]
RL3_THEVO1.815e-1434.6250S ribosomal protein L3P OS=Thermoplasma volcaniu... [more]
RL3_METHJ1.815e-1438.4650S ribosomal protein L3P OS=Methanospirillum hung... [more]
RL3_THEAC2.371e-1434.6250S ribosomal protein L3P OS=Thermoplasma acidophi... [more]
RL3_PYRAE3.097e-1444.7650S ribosomal protein L3P OS=Pyrobaculum aerophilu... [more]
RL3_METB64.044e-1434.7150S ribosomal protein L3P OS=Methanoregula boonei ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top