DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_NATPD (50S ribosomal protein L3P OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.282e-14
Identity = 38/97 (39.18%), Postives = 56/97 (57.73%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSL 323
            R++  +G W+P+RV  TV + GQ GYH RTE+NK++  LG                + D++P GGF +YG V+  Y L+KG   GP KR+V  R ++
Sbjct:  234 RRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDLG----------------DDDVSPDGGFVNYGEVDGPYALVKGSVPGPDKRLVRFRPAV 314          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_HALSA (50S ribosomal protein L3P OS=Halobacterium salinarium GN=rpl3p PE=3 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 5.282e-14
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R++  +G W+P+RV  TV + GQ GYH RTE+NK++  +    +                TP GGFP+YG V+  Y L+KG   GP++R+V  R ++    S     E+  +++ T+S  G
Sbjct:  232 RRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDINDGDEP---------------TPDGGFPNYGEVDGPYTLVKGSVPGPEQRLVRFRPAVRPNESPRLDPEV--RYVSTASNQG 335          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_HALS3 (50S ribosomal protein L3P OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.282e-14
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R++  +G W+P+RV  TV + GQ GYH RTE+NK++  +    +                TP GGFP+YG V+  Y L+KG   GP++R+V  R ++    S     E+  +++ T+S  G
Sbjct:  232 RRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDINDGDEP---------------TPDGGFPNYGEVDGPYTLVKGSVPGPEQRLVRFRPAVRPNESPRLDPEV--RYVSTASNQG 335          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRAR (50S ribosomal protein L3P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.010e-14
Identity = 45/105 (42.86%), Postives = 58/105 (55.24%), Query Frame = 3
Query:    6 LPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLR 314
            LPR  K  +G R+   IG   PA + FT  R GQ G+H RTE NK++ K+G+   E              ITP  GFPHYGV+   Y+LI+G   G +KR+V LR
Sbjct:  224 LPRWHKHRKGHRRTGTIGPQAPA-LMFTQPRPGQMGFHQRTEYNKRLLKIGENGAE--------------ITPKSGFPHYGVIKGPYILIQGSLPGARKRLVVLR 313          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRCJ (50S ribosomal protein L3P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.537e-13
Identity = 45/105 (42.86%), Postives = 57/105 (54.29%), Query Frame = 3
Query:    6 LPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLR 314
            LPR  K  +G R+   IG   PA + FT  R GQ G+H RTE NK+I K+G    E              ITP  GFPHYGV+   Y+L++G   G +KR+V LR
Sbjct:  224 LPRWHKHRKGHRRTGTIGPQAPA-LMFTQPRPGQMGFHQRTEYNKRILKIGDNGAE--------------ITPKSGFPHYGVIKGPYILLQGSVPGARKRLVVLR 313          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_METLZ (50S ribosomal protein L3P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.621e-13
Identity = 43/124 (34.68%), Postives = 66/124 (53.23%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIK---LKFIDTSSKFG 395
            R +  +G W P  V + V   GQ G+  RTE NK+I K+G+ + E              I P GGF HYG+V  +Y+LIKG   GP KR+V +R +     +R+  ++I+   ++++   SK G
Sbjct:  229 RHIGTLGPWTPHHVRWQVPMPGQMGFQQRTEFNKRIIKIGENADE--------------INPAGGFLHYGLVRNNYVLIKGSIPGPAKRLVRIRSA-----TRMGEQKIQAPVVEYVSLQSKQG 333          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_PYRIL (50S ribosomal protein L3P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.471e-13
Identity = 47/105 (44.76%), Postives = 56/105 (53.33%), Query Frame = 3
Query:    6 LPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLR 314
            LPR  K  +G R+   IG   PA V FT  R GQ G+H RTE NK+I K+G    E              ITP  GF HYGVV   Y+LI+G   G +KR+V LR
Sbjct:  228 LPRWHKHRKGHRRTGTIGPQAPA-VMFTQPRPGQMGFHQRTEYNKRIIKIGDNGAE--------------ITPKSGFLHYGVVKGPYILIQGTVPGARKRLVVLR 317          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_THENV (50S ribosomal protein L3P OS=Thermoproteus neutrophilus (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.627e-13
Identity = 45/105 (42.86%), Postives = 56/105 (53.33%), Query Frame = 3
Query:    6 LPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLR 314
            LPR  K  +G R+   IG   PA + FT  R GQ G+H RTE NK++ K+G    E              ITP  GF HYGV+   Y+LI+G   G KKR+V LR
Sbjct:  224 LPRWHKHRKGHRRTGTIGPQAPA-LMFTQPRPGQMGFHQRTEYNKRVVKIGDNGAE--------------ITPKSGFLHYGVIRGPYILIQGTVPGAKKRLVVLR 313          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_HALMA (50S ribosomal protein L3P OS=Haloarcula marismortui GN=rpl3p PE=1 SV=5)

HSP 1 Score: 72.4034 bits (176), Expect = 2.219e-12
Identity = 36/97 (37.11%), Postives = 54/97 (55.67%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSL 323
            R++  +G W+P+RV  TV + GQ GYH RTE+NK++  +G+  +                T  GGF +YG V+  Y L+KG   GP KR+V  R ++
Sbjct:  235 RRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEP---------------TVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAV 316          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_HALWD (50S ribosomal protein L3P OS=Haloquadratum walsbyi (strain DSM 16790) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.433e-12
Identity = 39/121 (32.23%), Postives = 65/121 (53.72%), Query Frame = 3
Query:   33 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 395
            R++  +G W+P+RV  TV + GQ GYH RTE+NK++ ++G   +                T  GGF  YG V+  Y LIKG   GP +R++  R ++  + S     + +++++ T+S  G
Sbjct:  235 RRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIEIGNGDEP---------------TVDGGFVGYGEVDGPYALIKGSLPGPDQRLLRFRTAV--RPSDQPRLDPEVRYVSTASNQG 338          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3_NATPD5.282e-1439.1850S ribosomal protein L3P OS=Natronomonas pharaoni... [more]
RL3_HALSA5.282e-1433.8850S ribosomal protein L3P OS=Halobacterium salinar... [more]
RL3_HALS35.282e-1433.8850S ribosomal protein L3P OS=Halobacterium salinar... [more]
RL3_PYRAR9.010e-1442.8650S ribosomal protein L3P OS=Pyrobaculum arsenatic... [more]
RL3_PYRCJ1.537e-1342.8650S ribosomal protein L3P OS=Pyrobaculum calidifon... [more]
RL3_METLZ2.621e-1334.6850S ribosomal protein L3P OS=Methanocorpusculum la... [more]
RL3_PYRIL4.471e-1344.7650S ribosomal protein L3P OS=Pyrobaculum islandicu... [more]
RL3_THENV7.627e-1342.8650S ribosomal protein L3P OS=Thermoproteus neutrop... [more]
RL3_HALMA2.219e-1237.1150S ribosomal protein L3P OS=Haloarcula marismortu... [more]
RL3_HALWD8.433e-1232.2350S ribosomal protein L3P OS=Haloquadratum walsbyi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top