DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_NANEQ (50S ribosomal protein L3P OS=Nanoarchaeum equitans GN=rpl3p PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.879e-11
Identity = 44/129 (34.11%), Postives = 65/129 (50.39%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSK 389
            R   K+ +G+RKV  IG+  P R+  TV   GQ GYH RTE NK I K+G                 + +   GG+  YG V    +L+KG   GP+KR++ LR+++     +  +E I  ++I  S K
Sbjct:  211 RRQHKSEKGVRKVGAIGSRGPGRIFPTVPMPGQMGYHRRTEYNKLIIKIG-----------------EPLNVEGGWVRYGQVIGPTILLKGSVPGPRKRLIILREAIRPPRKQEKVEGI--EYISLSPK 320          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_CALMQ (50S ribosomal protein L3P OS=Caldivirga maquilingensis (strain DSMZ 13496 / IC-167) GN=rpl3p PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.466e-11
Identity = 42/105 (40.00%), Postives = 54/105 (51.43%), Query Frame = 3
Query:    6 LPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLR 314
            LPR  K  +G R+   +G   PA V +T  R GQ G+H RTE NK+I K+     E              ITP GGF HYG+V   Y+LI+G   G  KR++  R
Sbjct:  228 LPRWHKHRKGSRRTGTVGP-KPA-VMYTQPRMGQMGFHRRTEYNKRILKISDNGSE--------------ITPKGGFKHYGIVRSGYMLIEGSTPGVVKRLIAFR 316          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3_NANEQ1.879e-1134.1150S ribosomal protein L3P OS=Nanoarchaeum equitans... [more]
RL3_CALMQ5.466e-1140.0050S ribosomal protein L3P OS=Caldivirga maquilinge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top