DC900116

Overview
NameDC900116
Unique NameDC900116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1107
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3510 contig Csv1_Contig3510:263..1369. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_YEAST (Phosphoenolpyruvate carboxykinase [ATP] OS=Saccharomyces cerevisiae GN=PCK1 PE=1 SV=2)

HSP 1 Score: 354.755 bits (909), Expect = 5.403e-97
Identity = 168/294 (57.14%), Postives = 216/294 (73.47%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVG-PHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSY-GCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQA-YKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPNF 937
            D +R LIGDDEHCW D+GV NIEGGCYAKCI+LS EKEP+I++AIKFG+VLENV++DE +  VDY D S+TENTR AYPI+YIP+AKIPC+   HPKN+ILL CDA GVLPPVSKL   Q MYHFISGYT+ +AGTE G+ EP  TFS+CFG  F+ LHP +YA MLA KM +H A  +L+NTGW+G SY   G R  L YTR I+D+IH GSL N  Y+   +F +++PT+V GVP+E+L+P   W+  ++ Y+  +  LA LF +NF+I+        ++ T ++L  GP F
Sbjct:  262 DPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIY-------QDRATPDVLAAGPQF 548          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA2_SALRD (Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Salinibacter ruber (strain DSM 13855) GN=pckA2 PE=3 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 2.053e-96
Identity = 169/267 (63.30%), Postives = 202/267 (75.66%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFE 865
            D NR LIGDDEHCW D+GV NIEGGCYAK + LS E+EP+I+NAI++G VLEN+V+DE TR VDY D S+T+NTRA+YP++YI  AKIP +G HP N+I L  DAFGV+PPVSKL   Q MYHFISGYTA VAGTE G+ EP ATFSACFGAAF++  P KYA MLAEK++ H A  WLVNTG +GG YG G R+ L +TR +IDAIH GSLL+A  K   VFG+++PTE   VP++IL P  TW D QAY E    L GLF  +FE
Sbjct:  244 DPNRKLIGDDEHCWSDDGVFNIEGGCYAKAVGLSEEEEPEIYNAIRYGTVLENMVYDEDTRAVDYDDTSITQNTRASYPLDYIDRAKIPGMGGHPDNIIFLTYDAFGVMPPVSKLTPEQAMYHFISGYTAKVAGTEVGVDEPQATFSACFGAAFLVWPPDKYAEMLAEKIRAHDAEAWLVNTGITGGPYGVGHRVPLEHTRAMIDAIHDGSLLDAPKKTEPVFGLDVPTECPNVPNDILMPRETWDDPQAYDEKAEHLVGLFHDHFE 510          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_EMENI (Phosphoenolpyruvate carboxykinase [ATP] OS=Emericella nidulans GN=acuF PE=3 SV=2)

HSP 1 Score: 349.747 bits (896), Expect = 1.738e-95
Identity = 168/291 (57.73%), Postives = 209/291 (71.82%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVG-PHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSG-GSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            D  R LIGDDEHCW D GV NIEGGCYAKCI LS EKEPDI+NAI+FG+VLENVVFD  +R VDY D ++TENTR AYPIEYI NAK+PC+   HP N+ILL CDA GVLPP+SKL   QTM+HFISGYT+ +AGTEDG+ EP ATFS+CF   F+ LHP +YA MLA+K+ +H A  WL+NTGW G G+   G R  L YTR I+DAIHSG L  A Y+  DVF + +P    GVP E+L+P+N+W    ++ + + KLA LF  NF+ +        ++ T+E++  GP
Sbjct:  270 DPKRALIGDDEHCWTDRGVFNIEGGCYAKCIGLSAEKEPDIFNAIRFGSVLENVVFDPISRVVDYDDSTLTENTRCAYPIEYIENAKVPCLSDSHPSNIILLTCDARGVLPPISKLTTEQTMFHFISGYTSKMAGTEDGVTEPQATFSSCFAQPFLALHPMRYARMLADKISQHKANAWLLNTGWVGAGATTGGKRCPLKYTRAILDAIHSGELAKAEYETYDVFNLHVPKSCPGVPDELLNPKNSWTATTSFSDEVNKLAKLFNENFQKYA-------DQATKEVIAAGP 553          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_THETN (Phosphoenolpyruvate carboxykinase [ATP] OS=Thermoanaerobacter tengcongensis GN=pckA PE=3 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 8.926e-92
Identity = 165/310 (53.23%), Postives = 205/310 (66.13%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            KDG  A               D  R+LIGDDEH W + G+ N EGGCYAKCI+LSREKEP IW++I+FGA+LENVV+DE TRE+DY+   +TENTRAAYPI++IP A    +G HPK +I L  DAFGVLPP++KL   Q MY+F+SGYT+ +AGTE GI EP ATFS CFGA F+ L P  YA ML EK++K+    +LVNTGWSGG YG G RI L YTRK++ A   G L    + K  +F + IP    GVPSEIL+P NTW DK+ Y +T  +LA  F  NF+        K  +++EEI   GP
Sbjct:  218 KDGDTALFFGLSGTGKTTLSADPERFLIGDDEHGWSERGIFNFEGGCYAKCINLSREKEPQIWDSIRFGAILENVVYDEATRELDYTSDKITENTRAAYPIDFIPGAVQSGIGGHPKTIIFLTADAFGVLPPIAKLTKEQAMYYFLSGYTSKLAGTERGITEPQATFSTCFGAPFLPLPPMVYAKMLGEKIEKYDTKVFLVNTGWSGGPYGIGKRINLEYTRKMVSAALKGELDKVEFTKDPIFNLNIPASCPGVPSEILNPRNTWKDKEEYDKTAKRLAQRFIENFQ--------KYKEVSEEIKNAGP 519          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACWK (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus weihenstephanensis (strain KBAB4) GN=pckA PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 5.786e-91
Identity = 163/290 (56.21%), Postives = 199/290 (68.62%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AIKFG+VLENVV D  TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  SG L  A   K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAIKFGSVLENVVIDGQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALSGELAKAETAKHDIFGLEVPRHVPGVPDEVLMPEQTWADKDAYKVKAIELANEFKENFKKF 513          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_LYSSC (Phosphoenolpyruvate carboxykinase [ATP] OS=Lysinibacillus sphaericus (strain C3-41) GN=pckA PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 3.750e-90
Identity = 160/271 (59.04%), Postives = 192/271 (70.85%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTN 877
            D +R LIGDDEH W DNGV NIEGGCYAK I+LS EKEP+I+NAI+FG+VLENV  D  TR  DY D S+TENTR AYPI+YI N   P V  HPK +I L  DAFGVLPP+SKL   Q MYHF+SG+T+ +AGTE G+ EP   FS CFG+ F+ L  T YA ML +K+ +HGA  +LVNTGW+GG YG GSR+KL YTR ++ A   G L N    +  VFG+ IPT VEGVPS++L+P   WADK AY     +LAGLF  NF+ F N
Sbjct:  245 DPDRKLIGDDEHGWSDNGVFNIEGGCYAKTINLSAEKEPEIYNAIRFGSVLENVAVDPETRICDYDDGSLTENTRVAYPIQYIENIVDPSVAGHPKTIIFLTADAFGVLPPISKLTKEQAMYHFLSGFTSKLAGTERGVTEPEPVFSTCFGSPFLPLPATVYAEMLGQKIDEHGAQVYLVNTGWTGGEYGTGSRMKLSYTRTMVRAAIDGKLTNVETTQDAVFGLHIPTAVEGVPSQVLNPREAWADKAAYDAKAAELAGLFNENFKKFAN 515          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACC2 (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain G9842) GN=pckA PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 4.898e-90
Identity = 160/290 (55.17%), Postives = 198/290 (68.28%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AIKFG+VLENV+ +  TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  SG L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAIKFGSVLENVIINNQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALSGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKENFKKF 513          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACCN (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus subsp. cytotoxis (strain NVH 391-98) GN=pckA PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 6.397e-90
Identity = 161/298 (54.03%), Postives = 204/298 (68.46%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKD 895
            ++G VA               D +R LIGDDEH W DNGV NIEGGCYAKCI+LS EKEP I++AIKFG+VLENV+ D+ TR  DYSD ++TENTRAAYPI+ I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR ++ A  +G L      K D+FG+++P  V  VP E+L PE TWAD+ AYK+  ++LA  FK NF+ F N  + KD
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPHRKLIGDDEHGWSDNGVFNIEGGCYAKCINLSHEKEPQIFDAIKFGSVLENVIVDDKTRIADYSDTALTENTRAAYPIDAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLAYTRAMVQAALNGELDKVETVKHDIFGLDVPLHVPSVPDEVLMPEQTWADQAAYKQKAIELANQFKENFKKFDN--VSKD 519          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACHK (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus thuringiensis subsp. konkukian GN=pckA PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.425e-89
Identity = 162/309 (52.43%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  SG L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALSGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACCQ (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain Q1) GN=pckA PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.425e-89
Identity = 162/309 (52.43%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  SG L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALSGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
The following BLAST results are available for this feature:
BLAST of DC900116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_YEAST5.403e-9757.14Phosphoenolpyruvate carboxykinase [ATP] OS=Sacchar... [more]
PCKA2_SALRD2.053e-9663.30Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Salin... [more]
PCKA_EMENI1.738e-9557.73Phosphoenolpyruvate carboxykinase [ATP] OS=Emerice... [more]
PCKA_THETN8.926e-9253.23Phosphoenolpyruvate carboxykinase [ATP] OS=Thermoa... [more]
PCKA_BACWK5.786e-9156.21Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_LYSSC3.750e-9059.04Phosphoenolpyruvate carboxykinase [ATP] OS=Lysinib... [more]
PCKA_BACC24.898e-9055.17Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACCN6.397e-9054.03Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACHK1.425e-8952.43Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACCQ1.425e-8952.43Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900116 VSS Citrus sinensis cDNA clone VS27V30 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900116 ID=DC900116|Name=DC900116|organism=Citrus sinensis|type=EST|length=1107bp
AAAAGATGGCNATGTTGCCCTCTTCTTTGGATTGTCAGGTACTGGAAAGA
CAACACTGTCTACTGATCACAATCGATATCTGATTGGAGACGATGAACAC
TGTTGGGGTGACAATGGTGTGTCAAACATTGAGGGTGGTTGCTATGCCAA
GTGCATTGATCTCTCAAGGGAGAAGGAGCCTGATATCTGGAATGCCATCA
AGTTTGGCGCTGTGTTGGAAAATGTTGTGTTTGATGAGCATACCAGAGAG
GTGGATTATTCTGACAAATCTGTCACAGAGAACACTCGTGCTGCCTACCC
CATTGAGTATATCCCCAATGCAAAGATACCATGCGTTGGTCCTCATCCCA
AGAATGTCATCCTTTTGGCATGTGATGCTTTTGGTGTACTCCCACCAGTG
AGCAAGCTGAACCTGGCACAAACAATGTACCATTTCATCAGTGGCTACAC
TGCTTTGGTAGCTGGAACAGAGGATGGTATTAAGGAGCCAACGGCAACAT
TTTCAGCTTGCTTTGGTGCAGCATTTATCATGCTGCATCCTACCAAGTAT
GCAGCAATGCTGGCTGAGAAGATGCAGAAGCATGGTGCTACAGGATGGCT
CGTCAACACTGGATGGTCAGGTGGAAGCTATGGTTGTGGCAGCCGCATCA
AGTTACCGTACACTCGAAAAATCATTGATGCGATACACTCTGGCAGCCTG
TTGAATGCAAATTACAAGAAAACTGATGTATTTGGGGTGGAAATCCCCAC
TGAAGTCGAGGGAGTGCCTTCAGAAATCCTGGATCCAGAGAACACTTGGG
CAGACAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTC
AAGAGGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAA
GCTCACTGAAGAGATCCTTGNANCTGGTCCAAATTTCTAATTTAGACCGA
GTGAAGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAA
TAAAGCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAA
ACTTGTTCTCCTGNATTAATTAAGTAATCCAAAAATTTGAGTCANCGATT
TTAATTA
back to top