DC900116

Overview
NameDC900116
Unique NameDC900116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1107
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3510 contig Csv1_Contig3510:263..1369. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACC7 (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain AH187) GN=pckA PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.425e-89
Identity = 162/309 (52.43%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  SG L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALSGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_CANAL (Phosphoenolpyruvate carboxykinase [ATP] OS=Candida albicans GN=PCK1 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 2.431e-89
Identity = 162/292 (55.48%), Postives = 199/292 (68.15%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGS--YGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWAD-KQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            D  R LIGDDEHCW DNGV NIEGGCYAKC+DLS EKEP+I+N+IKFGA+LENVV+   T+ VDY D S+TENTR AYPI++IP+AKIPC+        LL CDA GVL  VSKL  AQ MYHFISGYT+ +AG+E+G+ EP ATFSACFG  F++LHP KYA  LA+K+ +H A  WL+NTGW G S   G G R  L YTR I+DAIHSG L    Y+K  VF + +PT   GVPSEIL+P   W     ++ + +  LA  F  NF+ +        ++ T E+   GP
Sbjct:  267 DPQRKLIGDDEHCWSDNGVFNIEGGCYAKCLDLSAEKEPEIFNSIKFGAILENVVYXXITKVVDYGDSSITENTRCAYPIDFIPSAKIPCLPTPIPQYYLLTCDASGVLATVSKLTNAQVMYHFISGYTSKMAGSEEGVTEPHATFSACFGQPFLVLHPMKYAQQLADKISEHNANAWLLNTGWVGSSVAQGGGKRCPLKYTRAILDAIHSGELSKVEYEKVPVFNLNVPTSCPGVPSEILNPTKAWTQGTDSFNKEIKSLATKFAENFKTYA-------DQATAEVKAAGP 551          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACCZ (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain ZK / E33L) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.175e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACCR (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.175e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACC4 (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain B4264) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.175e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACC3 (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain 03BB102) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.175e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACC1 (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain ATCC 10987) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.175e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACC0 (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain AH820) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.175e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACAH (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus thuringiensis (strain Al Hakam) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.175e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIVLPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACAN (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus anthracis GN=pckA PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.146e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIILPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
The following BLAST results are available for this feature:
BLAST of DC900116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_BACC71.425e-8952.43Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_CANAL2.431e-8955.48Phosphoenolpyruvate carboxykinase [ATP] OS=Candida... [more]
PCKA_BACCZ3.175e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACCR3.175e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACC43.175e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACC33.175e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACC13.175e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACC03.175e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACAH3.175e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_BACAN4.146e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900116 VSS Citrus sinensis cDNA clone VS27V30 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900116 ID=DC900116|Name=DC900116|organism=Citrus sinensis|type=EST|length=1107bp
AAAAGATGGCNATGTTGCCCTCTTCTTTGGATTGTCAGGTACTGGAAAGA
CAACACTGTCTACTGATCACAATCGATATCTGATTGGAGACGATGAACAC
TGTTGGGGTGACAATGGTGTGTCAAACATTGAGGGTGGTTGCTATGCCAA
GTGCATTGATCTCTCAAGGGAGAAGGAGCCTGATATCTGGAATGCCATCA
AGTTTGGCGCTGTGTTGGAAAATGTTGTGTTTGATGAGCATACCAGAGAG
GTGGATTATTCTGACAAATCTGTCACAGAGAACACTCGTGCTGCCTACCC
CATTGAGTATATCCCCAATGCAAAGATACCATGCGTTGGTCCTCATCCCA
AGAATGTCATCCTTTTGGCATGTGATGCTTTTGGTGTACTCCCACCAGTG
AGCAAGCTGAACCTGGCACAAACAATGTACCATTTCATCAGTGGCTACAC
TGCTTTGGTAGCTGGAACAGAGGATGGTATTAAGGAGCCAACGGCAACAT
TTTCAGCTTGCTTTGGTGCAGCATTTATCATGCTGCATCCTACCAAGTAT
GCAGCAATGCTGGCTGAGAAGATGCAGAAGCATGGTGCTACAGGATGGCT
CGTCAACACTGGATGGTCAGGTGGAAGCTATGGTTGTGGCAGCCGCATCA
AGTTACCGTACACTCGAAAAATCATTGATGCGATACACTCTGGCAGCCTG
TTGAATGCAAATTACAAGAAAACTGATGTATTTGGGGTGGAAATCCCCAC
TGAAGTCGAGGGAGTGCCTTCAGAAATCCTGGATCCAGAGAACACTTGGG
CAGACAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTC
AAGAGGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAA
GCTCACTGAAGAGATCCTTGNANCTGGTCCAAATTTCTAATTTAGACCGA
GTGAAGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAA
TAAAGCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAA
ACTTGTTCTCCTGNATTAATTAAGTAATCCAAAAATTTGAGTCANCGATT
TTAATTA
back to top