DC900116

Overview
NameDC900116
Unique NameDC900116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1107
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3510 contig Csv1_Contig3510:263..1369. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BAUCH (Phosphoenolpyruvate carboxykinase [ATP] OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pckA PE=3 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 9.625e-62
Identity = 127/271 (46.86%), Postives = 170/271 (62.73%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPC-VGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFT 874
            D NR LIGDDEH W ++G+ N+EGGCYAK I+L  E EP+I+ AI+  A+LENV+       V+Y D S T+N R +YP+ +I N   P     H   +I L  DAFGVLPPV+ L   Q  Y+F+SG++A ++GTE GI  P  TFSACFGAAF+ LHPT YAA+LA++M   G   +LVNTGW+G     GSRI L  T+ II+AI +  + +    K  +F + IP  + GV S ILDP  ++ +   ++     LA LF +NF  FT
Sbjct:  258 DTNRALIGDDEHGWDNDGIFNLEGGCYAKTINLKPELEPEIFQAIRCNALLENVMV-RADGSVNYHDNSKTDNARVSYPLNHIKNRVQPVSCASHASTIIFLTADAFGVLPPVATLTNEQAQYYFLSGFSAKLSGTERGIISPVPTFSACFGAAFLALHPTVYAALLAKRMNIAGTNAYLVNTGWNGN----GSRIALKDTKAIINAILNKQIQDTPTIKLPIFNLSIPQILIGVDSNILDPRTSYINSSEWQNKARSLAQLFIKNFNKFT 523          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_DEIRA (Phosphoenolpyruvate carboxykinase [ATP] OS=Deinococcus radiodurans GN=pckA PE=3 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 1.390e-60
Identity = 121/223 (54.26%), Postives = 147/223 (65.92%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIK-FGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTR 667
            +DG VA               D  R LIGDDEH W D GV N EGGCYAK I+LS E EP I+   + +G VLENVV DE +   D  D S+TENTR+AYPIE I N +   VG  PKNV+ L  DAFGVLPP+S+L   Q MY FISG+TA + GTE+G+ +PT TFS CFGA F+  HP +YA +LA+K+++ GA  WLVNTGW+GG YG G R+ L  TR
Sbjct:  228 EDGDVALFFGLSGTGKTTLSADPGRKLIGDDEHGWTDTGVFNFEGGCYAKVINLSAEAEPAIYQTTRNYGTVLENVVLDE-SGTPDLDDGSLTENTRSAYPIEQIANIQPGSVGGIPKNVVFLTADAFGVLPPLSRLTPEQMMYQFISGFTAKIPGTEEGVTDPTPTFSTCFGAPFMPRHPGEYARLLAQKVEESGAKVWLVNTGWTGGKYGEGHRMSLNLTR 449          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_TRYBB (Phosphoenolpyruvate carboxykinase [ATP], glycosomal OS=Trypanosoma brucei brucei PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.537e-59
Identity = 115/220 (52.27%), Postives = 147/220 (66.82%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDG-IKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGS-RIKLPYTRKIIDAIHSGSLLNANYK 718
            D  R LIGDDEH W D GV NIEGGCYAK I L+ E E DI+ A++FGAV EN   D  T E+D++D+S+ +NTR AYP+ +I  A    V  HPKN+I L  DAFGV+PPV++L  AQ M+ F+ GYTA V G E G  +     FS+CFG  F++ H T Y   LAEKM+KH +  WL+NTG++GG    G+ R+ L  TR IIDAIH G+L  A+Y+
Sbjct:  233 DPRRNLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPETEKDIYEAVRFGAVAENCTLDRRTHEIDFNDESICKNTRVAYPLMHIDGALSKAVAGHPKNIIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGVEAGSARVARPIFSSCFGGPFLVRHATHYGQQLAEKMEKHNSRVWLLNTGYAGGRADRGAKRMPLRVTRAIIDAIHDGTLDQADYE 452          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_TRYCR (Phosphoenolpyruvate carboxykinase [ATP], glycosomal OS=Trypanosoma cruzi GN=PEPCK PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 2.007e-59
Identity = 115/221 (52.04%), Postives = 149/221 (67.42%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTE-DGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGS-RIKLPYTRKIIDAIHSGSLLNANYKK 721
            D +R LIGDDEH W D GV NIEGGCYAK I L+ + E DI++A++FGAV EN V D+ T E+D+ D+S+ +NTR AYP+ +I  A    +  HPKNVI L  DAFGV+PPV++L  AQ M+ F+ GYTA V G E  G +     FS+CFG  F++ H T Y   LAEKMQKH +  WL+NTG++GG    G+ R+ L  TR IIDAIH G+L    Y++
Sbjct:  233 DPHRNLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTRVAYPLSHIEGALSKAIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGVEAGGTRTARPIFSSCFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGRADRGAKRMPLRVTRAIIDAIHDGTLDRTEYEE 453          
The following BLAST results are available for this feature:
BLAST of DC900116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_BAUCH9.625e-6246.86Phosphoenolpyruvate carboxykinase [ATP] OS=Baumann... [more]
PCKA_DEIRA1.390e-6054.26Phosphoenolpyruvate carboxykinase [ATP] OS=Deinoco... [more]
PCKA_TRYBB1.537e-5952.27Phosphoenolpyruvate carboxykinase [ATP], glycosoma... [more]
PCKA_TRYCR2.007e-5952.04Phosphoenolpyruvate carboxykinase [ATP], glycosoma... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900116 VSS Citrus sinensis cDNA clone VS27V30 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900116 ID=DC900116|Name=DC900116|organism=Citrus sinensis|type=EST|length=1107bp
AAAAGATGGCNATGTTGCCCTCTTCTTTGGATTGTCAGGTACTGGAAAGA
CAACACTGTCTACTGATCACAATCGATATCTGATTGGAGACGATGAACAC
TGTTGGGGTGACAATGGTGTGTCAAACATTGAGGGTGGTTGCTATGCCAA
GTGCATTGATCTCTCAAGGGAGAAGGAGCCTGATATCTGGAATGCCATCA
AGTTTGGCGCTGTGTTGGAAAATGTTGTGTTTGATGAGCATACCAGAGAG
GTGGATTATTCTGACAAATCTGTCACAGAGAACACTCGTGCTGCCTACCC
CATTGAGTATATCCCCAATGCAAAGATACCATGCGTTGGTCCTCATCCCA
AGAATGTCATCCTTTTGGCATGTGATGCTTTTGGTGTACTCCCACCAGTG
AGCAAGCTGAACCTGGCACAAACAATGTACCATTTCATCAGTGGCTACAC
TGCTTTGGTAGCTGGAACAGAGGATGGTATTAAGGAGCCAACGGCAACAT
TTTCAGCTTGCTTTGGTGCAGCATTTATCATGCTGCATCCTACCAAGTAT
GCAGCAATGCTGGCTGAGAAGATGCAGAAGCATGGTGCTACAGGATGGCT
CGTCAACACTGGATGGTCAGGTGGAAGCTATGGTTGTGGCAGCCGCATCA
AGTTACCGTACACTCGAAAAATCATTGATGCGATACACTCTGGCAGCCTG
TTGAATGCAAATTACAAGAAAACTGATGTATTTGGGGTGGAAATCCCCAC
TGAAGTCGAGGGAGTGCCTTCAGAAATCCTGGATCCAGAGAACACTTGGG
CAGACAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTC
AAGAGGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAA
GCTCACTGAAGAGATCCTTGNANCTGGTCCAAATTTCTAATTTAGACCGA
GTGAAGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAA
TAAAGCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAA
ACTTGTTCTCCTGNATTAATTAAGTAATCCAAAAATTTGAGTCANCGATT
TTAATTA
back to top