DC900116

Overview
NameDC900116
Unique NameDC900116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1107
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3510 contig Csv1_Contig3510:263..1369. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACAA (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus anthracis (strain A0248) GN=pckA PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.146e-89
Identity = 161/309 (52.10%), Postives = 206/309 (66.67%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXG 928
            ++G VA               D NR LIGDDEH W DNGV NIEGGCYAKC++LS EKEP I++AI FG+VLENV+ ++ TR  DY+D ++TENTRAAYP+  I N  +P V  HP  +I L  DA GVLPP+SKL+  Q MYHF+SGYT+ +AGTE G+  P ATFS CFG+ F+ L  ++YA ML EK++KH A  +LVNTGW+GG YG G R+ L YTR +I A  +G L      K D+FG+E+P  V GVP E+L PE TWADK AYK   ++LA  FK NF+ F        + ++E+I+  G
Sbjct:  224 EEGDVALFFGLSGTGKTTLSADPNRKLIGDDEHGWSDNGVFNIEGGCYAKCVNLSHEKEPQIFDAITFGSVLENVIINDQTRIADYNDTTLTENTRAAYPMHAIDNIILPSVAGHPNTIIFLTADASGVLPPISKLSKEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGSPFLPLDASRYAEMLGEKIEKHDAKVFLVNTGWTGGEYGVGKRMNLGYTRAMIQAALNGELAKTETAKHDIFGLEVPLHVPGVPDEVLMPEQTWADKAAYKAKAIELANEFKANFKKF--------DSVSEDIINLG 524          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_LEPIN (Phosphoenolpyruvate carboxykinase [ATP] OS=Leptospira interrogans GN=pckA PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 7.072e-89
Identity = 163/288 (56.60%), Postives = 197/288 (68.40%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFE 865
            +DG  A               D NR LIGDDEH W DNG+ NIEGGCYAK I+L  + EPDI+ AI+  A+LENVV+D  T+ VDYS  + TENTR +YPI +I N ++P  G HPK +I L  DAFGVLPPVSKL++ Q MYHF+SGYTA VAGTE GIKEPTATFSACFGAAF+ LHPTKYA +L EKM+KH    +L+NTG  GGSYG G R+ LP TRKIID I +G++  + +    VF V  P  + GV S ILDP   W DK AY +T  KL  +F +NF+
Sbjct:  225 QDGDTALFFGLSGTGKTTLSTDPNRKLIGDDEHGWDDNGIFNIEGGCYAKVINLDPKTEPDIYEAIRKDALLENVVYDPQTKIVDYSSAAKTENTRVSYPIFHINNIQVPSKGGHPKTIIFLTYDAFGVLPPVSKLSIEQAMYHFLSGYTAKVAGTERGIKEPTATFSACFGAAFMTLHPTKYAKLLGEKMKKHNVRAYLMNTGLVGGSYGVGKRMNLPSTRKIIDEILNGNIEKSEFVTHPVFQVAYPKTISGVDSAILDPREAWTDKAAYDQTAKKLGEMFIKNFK 512          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_LEPIC (Phosphoenolpyruvate carboxykinase [ATP] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=pckA PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 7.072e-89
Identity = 163/288 (56.60%), Postives = 197/288 (68.40%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFE 865
            +DG  A               D NR LIGDDEH W DNG+ NIEGGCYAK I+L  + EPDI+ AI+  A+LENVV+D  T+ VDYS  + TENTR +YPI +I N ++P  G HPK +I L  DAFGVLPPVSKL++ Q MYHF+SGYTA VAGTE GIKEPTATFSACFGAAF+ LHPTKYA +L EKM+KH    +L+NTG  GGSYG G R+ LP TRKIID I +G++  + +    VF V  P  + GV S ILDP   W DK AY +T  KL  +F +NF+
Sbjct:  225 QDGDTALFFGLSGTGKTTLSTDPNRKLIGDDEHGWDDNGIFNIEGGCYAKVINLDPKTEPDIYEAIRKDALLENVVYDPQTKIVDYSSAAKTENTRVSYPIFHINNIQVPSKGGHPKTIIFLTYDAFGVLPPVSKLSIEQAMYHFLSGYTAKVAGTERGIKEPTATFSACFGAAFMTLHPTKYAKLLGEKMKKHNVRAYLMNTGLVGGSYGVGKRMNLPSTRKIIDEILNGNIEKSEFVTHPVFQVAYPKTISGVDSAILDPREAWTDKAAYDQTAKKLGEMFIKNFK 512          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA2_MOOTA (Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Moorella thermoacetica (strain ATCC 39073) GN=pckA2 PE=3 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 3.510e-88
Identity = 155/289 (53.63%), Postives = 196/289 (67.82%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            D  R LIGDDEH W D+G+ N EGGCYAKCI LS E EP IWNAI+FG+VLENV  D  +R +DY   ++TENTRAAYP+++IPNA IP +G HP+ V+ L  DAFGV+PP++KL   Q MYHF+SGYT+ +AGTE GI +P ATFS CFGA F+   P  YA +L E++ KHGA+ +LVNTGW+GG  G G R+ LPYTR ++ A   G L    +    VFG+ +PT   GVP+E+L+P +TW DK+ Y     KLAGLF  NF  F +        + EEI   GP
Sbjct:  243 DPERRLIGDDEHGWSDHGIFNFEGGCYAKCIKLSAEHEPQIWNAIRFGSVLENVAVDPDSRAIDYDCDALTENTRAAYPVDFIPNAVIPGIGGHPRTVVFLTADAFGVMPPIAKLTREQAMYHFLSGYTSKLAGTERGITDPQATFSTCFGAPFLPRSPRVYADLLGERIAKHGASVYLVNTGWTGGPSGIGRRMSLPYTRAMVRAAIKGELEGVEFVPDPVFGILVPTSCPGVPAEVLNPRHTWQDKEKYDAMARKLAGLFAENFTKFRD--------VPEEIRAAGP 523          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_NITSB (Phosphoenolpyruvate carboxykinase [ATP] OS=Nitratiruptor sp. (strain SB155-2) GN=pckA PE=3 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 5.987e-88
Identity = 165/272 (60.66%), Postives = 192/272 (70.59%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNY 880
            D NR LIGDDEH W DNGV N EGGCYAK I L  EKEPDI+ AIK  A+LENVV  E+  EVD+ D S TENTR +YPI +I   K    GPHPKN+I L+ DAFGVLPPVSKL   Q MY+F+SGYTA VAGTE GI EP ATFSACFG AF+ LHPT YA +L EK+ KHG   +LVNTGW+GG YG G R+ LP TR  I+AI +GS+  + Y+   +F +EIPT VEGV   IL+P NTW DK+AY   L  LA LF  NF+ +  Y
Sbjct:  243 DPNRRLIGDDEHGWDDNGVFNFEGGCYAKVIGLDPEKEPDIYAAIKRDALLENVVVKENG-EVDFEDSSKTENTRVSYPIYHICKHKEDLQGPHPKNIIFLSADAFGVLPPVSKLTKEQAMYYFLSGYTAKVAGTERGITEPVATFSACFGEAFLPLHPTVYAKLLGEKIDKHGVNVYLVNTGWTGGPYGIGQRMSLPATRSCINAILNGSITQSEYEILPIFNLEIPTYVEGVDPAILNPRNTWEDKEAYDRQLEHLAKLFIDNFKRYEGY 513          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_GEOUR (Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacter uraniireducens (strain Rf4) GN=pckA PE=3 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 6.620e-87
Identity = 152/268 (56.72%), Postives = 191/268 (71.27%), Query Frame = 2
Query:   71 NRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIF 871
            NR LIGDDEH W D+GV N EGGCYAK I+LS+E EP+I+    KFG +LENV  D  +R +D +D S TENTRA+YPI +IPN     +G HP NVI+L CDAFGVLPP+++L   Q MYHF+SGYTA VAGTE GI EP ATFS CFGA F+ LHP+ YA +L  K+ +H    WLVNTGWSGG+YG GSR+K+ Y+R +++A   G+L    ++K  VFG++IP    GVP E+L+P N WADK AY  T   L  +F++NFE F
Sbjct:  251 NRSLIGDDEHGWDDDGVFNFEGGCYAKIINLSKESEPEIYETTRKFGTILENVAIDTISRRIDLNDDSFTENTRASYPITHIPNIVPSGMGGHPTNVIMLTCDAFGVLPPIARLTPEQAMYHFLSGYTAKVAGTEAGITEPQATFSTCFGAPFMALHPSVYAELLKAKIARHKVNCWLVNTGWSGGAYGVGSRMKIGYSRALVNAALDGTLAAGQFEKDSVFGLDIPRACPGVPGEVLNPRNVWADKAAYDATAKDLVEMFRKNFEQF 518          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_BACSU (Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus subtilis GN=pckA PE=3 SV=3)

HSP 1 Score: 321.242 bits (822), Expect = 6.620e-87
Identity = 155/271 (57.20%), Postives = 186/271 (68.63%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTN 877
            D +R LIGDDEH W D GV NIEGGCYAKCI LS EKEP I+NAI+FG+VLENVV DE TRE +Y D   TENTRAAYPI  I N   P +  HP  ++ L  DAFGVLPP+SKL   Q MYHF+SGYT+ +AGTE G+  P  TFS CFG+ F+ L    YA ML +K+ +HGA  +LVNTGW+GG YG G R+KL YTR ++ A   G L +A     D+FG+ IP  V GVP  IL PENTW +K+ YKE  + LA  FK NF+ F +
Sbjct:  245 DADRKLIGDDEHGWSDTGVFNIEGGCYAKCIHLSEEKEPQIFNAIRFGSVLENVVVDEDTREANYDDSFYTENTRAAYPIHMINNIVTPSMAGHPSAIVFLTADAFGVLPPISKLTKEQAMYHFLSGYTSKLAGTERGVTSPETTFSTCFGSPFLPLPAHVYAEMLGKKIDEHGADVFLVNTGWTGGGYGTGERMKLSYTRAMVKAAIEGKLEDAEMITDDIFGLHIPAHVPGVPDHILQPENTWTNKEEYKEKAVYLANEFKENFKKFAH 515          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA1_MOOTA (Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=pckA1 PE=3 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 6.620e-87
Identity = 149/274 (54.38%), Postives = 190/274 (69.34%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKI 886
            D  RYLIGDDEH W D G+ N EGGCYAKCI LS E EP IWNAI+FG+VLENV+ D   R +DY   ++TENTRAAYP+++IPNA IP VG HP+ V+ L  DAFGV+PP++KL   Q MY+F+SGYT+ +AGTE G+ EP ATFS CFGA F+   P  YA +L E++ +H A+ +LVNTGW+GG YG G R+ LPYTR ++ A  +G L    +    VFG  +P    GVP+EIL+P NTWA+ + Y     KLA LF+ NF  F +  +
Sbjct:  243 DPERYLIGDDEHGWSDKGIFNFEGGCYAKCIKLSAEHEPQIWNAIRFGSVLENVMVDPDCRIIDYDSDALTENTRAAYPVDFIPNAVIPGVGGHPQTVVFLTADAFGVMPPIAKLTREQAMYYFLSGYTSKLAGTERGVTEPKATFSTCFGAPFLPRSPMVYANLLGERIARHNASVYLVNTGWTGGPYGTGRRMSLPYTRAMVRAALNGELDKVEFTPDPVFGFLVPKACPGVPAEILNPRNTWAETEKYDAMARKLASLFRENFAKFKDVPV 516          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_GEOMG (Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pckA PE=3 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 8.645e-87
Identity = 151/273 (55.31%), Postives = 195/273 (71.43%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIK-FGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNY 880
            D  R LIGDDEH W ++GV N EGGCYAK I+LS E EP+I+   + FG +LENV  D  +R +D +D S TENTRA+YPI +IPN     +G HP N+I+L CDAFGVLPP+++L   Q MYHF+SGYTA VAGTE GI EP A FSACFGA F+ LHP+ YA +L EK+ +HG + WLVNTGWSGG YG GSR+K+ Y+R +++A   G+L   ++ K   FG++IPT   GVP+E+L+P+NTW DK  Y ET   L   F++NFE + +Y
Sbjct:  249 DPRRRLIGDDEHGWDNSGVFNFEGGCYAKIINLSPEAEPEIYQTTRRFGTILENVAIDTVSRRIDLNDDSFTENTRASYPITHIPNIVKSGMGGHPTNIIMLTCDAFGVLPPIARLTPDQAMYHFLSGYTAKVAGTEAGITEPQAAFSACFGAPFMALHPSVYAKLLGEKIARHGVSCWLVNTGWSGGPYGVGSRMKIAYSRALVNAAIDGTLNAGSFVKDQFFGLDIPTGCSGVPAEVLNPKNTWVDKTKYDETATMLVERFRKNFEQYRSY 521          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_GEOKA (Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacillus kaustophilus GN=pckA PE=3 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.475e-86
Identity = 155/292 (53.08%), Postives = 197/292 (67.47%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTN 877
            ++G VA               D NR LIGDDEH W + G+ NIEGGCYAKCI+LSREKEP I++AI FGAVLENVV D+ TR  +Y D ++TENTRAAYP++ I N   P V  HP  ++ L  DAFGVLPP+SKL   Q MYHF+SGYT+ +AGTE G+ EP ATFS CFGA F+     +YA ML +K+ +H    +LVNTGW+GG YG GSR+KL YTR ++ A   G L N    +  +FG+ IP+ V GVP ++L P+NTWADKQAY++   +LA  F+ NF  F +
Sbjct:  224 QEGDVALFFGLSGTGKTTLSTDPNRRLIGDDEHGWSNRGIFNIEGGCYAKCINLSREKEPQIFDAIGFGAVLENVVLDDATRVPNYDDGTLTENTRAAYPLQAIKNIVDPSVAGHPSTIVFLTADAFGVLPPISKLTREQAMYHFLSGYTSKLAGTERGVTEPEATFSTCFGAPFLPRPAVEYAEMLGQKIAEHNVRVFLVNTGWTGGPYGVGSRMKLAYTRAMVQAAVEGELDNVETVQDPIFGLAIPSHVPGVPDDVLQPQNTWADKQAYEQKAKELAQKFRANFRKFAH 515          
The following BLAST results are available for this feature:
BLAST of DC900116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_BACAA4.146e-8952.10Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA_LEPIN7.072e-8956.60Phosphoenolpyruvate carboxykinase [ATP] OS=Leptosp... [more]
PCKA_LEPIC7.072e-8956.60Phosphoenolpyruvate carboxykinase [ATP] OS=Leptosp... [more]
PCKA2_MOOTA3.510e-8853.63Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Moore... [more]
PCKA_NITSB5.987e-8860.66Phosphoenolpyruvate carboxykinase [ATP] OS=Nitrati... [more]
PCKA_GEOUR6.620e-8756.72Phosphoenolpyruvate carboxykinase [ATP] OS=Geobact... [more]
PCKA_BACSU6.620e-8757.20Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillu... [more]
PCKA1_MOOTA6.620e-8754.38Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Moore... [more]
PCKA_GEOMG8.645e-8755.31Phosphoenolpyruvate carboxykinase [ATP] OS=Geobact... [more]
PCKA_GEOKA1.475e-8653.08Phosphoenolpyruvate carboxykinase [ATP] OS=Geobaci... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900116 VSS Citrus sinensis cDNA clone VS27V30 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900116 ID=DC900116|Name=DC900116|organism=Citrus sinensis|type=EST|length=1107bp
AAAAGATGGCNATGTTGCCCTCTTCTTTGGATTGTCAGGTACTGGAAAGA
CAACACTGTCTACTGATCACAATCGATATCTGATTGGAGACGATGAACAC
TGTTGGGGTGACAATGGTGTGTCAAACATTGAGGGTGGTTGCTATGCCAA
GTGCATTGATCTCTCAAGGGAGAAGGAGCCTGATATCTGGAATGCCATCA
AGTTTGGCGCTGTGTTGGAAAATGTTGTGTTTGATGAGCATACCAGAGAG
GTGGATTATTCTGACAAATCTGTCACAGAGAACACTCGTGCTGCCTACCC
CATTGAGTATATCCCCAATGCAAAGATACCATGCGTTGGTCCTCATCCCA
AGAATGTCATCCTTTTGGCATGTGATGCTTTTGGTGTACTCCCACCAGTG
AGCAAGCTGAACCTGGCACAAACAATGTACCATTTCATCAGTGGCTACAC
TGCTTTGGTAGCTGGAACAGAGGATGGTATTAAGGAGCCAACGGCAACAT
TTTCAGCTTGCTTTGGTGCAGCATTTATCATGCTGCATCCTACCAAGTAT
GCAGCAATGCTGGCTGAGAAGATGCAGAAGCATGGTGCTACAGGATGGCT
CGTCAACACTGGATGGTCAGGTGGAAGCTATGGTTGTGGCAGCCGCATCA
AGTTACCGTACACTCGAAAAATCATTGATGCGATACACTCTGGCAGCCTG
TTGAATGCAAATTACAAGAAAACTGATGTATTTGGGGTGGAAATCCCCAC
TGAAGTCGAGGGAGTGCCTTCAGAAATCCTGGATCCAGAGAACACTTGGG
CAGACAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTC
AAGAGGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAA
GCTCACTGAAGAGATCCTTGNANCTGGTCCAAATTTCTAATTTAGACCGA
GTGAAGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAA
TAAAGCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAA
ACTTGTTCTCCTGNATTAATTAAGTAATCCAAAAATTTGAGTCANCGATT
TTAATTA
back to top