DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METTH (Proteasome-activating nucleotidase OS=Methanobacterium thermoautotrophicum GN=pan PE=3 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.972e-76
Identity = 138/234 (58.97%), Postives = 177/234 (75.64%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLE 704
            ++ELPL  PELF ++GI+PPKGVLLYGPPGTGKTLLA+A+A   +A F+K+V+S  + KYIGE ARL+R +F  A++  P IIF+DEIDA+  +R    TS DRE+QRTLM+LL +LDGF+  G V ++ ATNRPD+LDPALLRPGR DR IE+PLPNE  R EILKIH +G+A   E+D E + ++ +G +GADL+ +CTEAGM AIR ERD V   DFM AV K+   +K E
Sbjct:  166 TVELPLKKPELFEKIGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIKIVASEFVRKYIGEGARLVRGVFELAKEKSPSIIFIDEIDAVAAKRLKSSTSGDREVQRTLMQLLAELDGFESRGNVGIVAATNRPDILDPALLRPGRFDRFIEVPLPNEDGRREILKIHTSGMALAEEVDIELLARITDGASGADLKAICTEAGMFAIRDERDEVTMADFMDAVDKIMGVEKEE 399          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_PRUPE (26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 4.744e-74
Identity = 128/226 (56.64%), Postives = 172/226 (76.11%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +ELP+++PE F+++GI PPKGVL YGPPGTGKTLLARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + CI+F DE+DAIGG RF +G   D E+QRT++E++NQLDGFD  G +K++MATNRPD LDPALLRPGRLDRK+E  LP+ +SR +I KIH   +    +I +E + +L     GAD+R+VCTEAGM AIRA R  V  +DF+ AV K+
Sbjct:  183 VELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLESRTQIFKIHTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKV 408          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7A_ARATH (26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 4.744e-74
Identity = 128/226 (56.64%), Postives = 172/226 (76.11%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +ELP+++PE F+++GI PPKGVL YGPPGTGKTLLARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + CI+F DE+DAIGG RF +G   D E+QRT++E++NQLDGFD  G +K++MATNRPD LDPALLRPGRLDRK+E  LP+ +SR +I KIH   +    +I +E + +L     GAD+R+VCTEAGM AIRA R  V  +DF+ AV K+
Sbjct:  184 VELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLESRTQIFKIHTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKV 409          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_PYRHO (Proteasome-activating nucleotidase OS=Pyrococcus horikoshii GN=pan PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 6.196e-74
Identity = 138/246 (56.10%), Postives = 180/246 (73.17%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL--NEAKKLESSAHYNADFG 734
            +IELPL +PELF  VGI PPKGVLLYGPPG GKTL+A+A+A  ++A F++VV S ++ KYIGE ARL+ E+F  A++  P IIF+DEIDAIG +R  E T  +RE+ RTLM+LL ++DGFD  G VK+I ATNRPD+LDPALLRPGR DR IE+PLP+ + R+EILK+H   +   G +D  A+ ++ EG +GADL+ + TEAGM AIR  R YV  EDF+KAV K+  NE K L+    +   +G
Sbjct:  155 AIELPLKHPELFEEVGIDPPKGVLLYGPPGCGKTLMAKALAHEVNATFIRVVGSELVRKYIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFEGRLEILKVHTRRMKLKG-VDLRAIAEMTEGASGADLKAIATEAGMFAIRERRTYVTQEDFLKAVDKVLGNERKLLQQITSHEVIYG 399          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METMJ (Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 6.196e-74
Identity = 140/227 (61.67%), Postives = 170/227 (74.89%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            ++ELPL  P+LF +VGI PPKGVLLYGPPGTGKTLLARA+A   +A+FL+VV S ++ KYIGE ARL+RE+F  A+   P IIF+DEIDAIG  R    TS DRE+QRTLM+LL ++DGFD  G VK++ ATNR D+LD ALLRPGR DR IEIPLP+ Q R+ ILKIH   +    +++   V +L EG NGADLR +C EAGM AIR ERD V  EDFMKA+ KL
Sbjct:  168 AVELPLTKPQLFEKVGISPPKGVLLYGPPGTGKTLLARAVAHQTNAHFLRVVGSELVQKYIGEGARLVRELFDLAKQRAPSIIFIDEIDAIGAHRNDSTTSGDREVQRTLMQLLAEMDGFDNRGDVKIVAATNRIDILDRALLRPGRFDRMIEIPLPDHQGRLAILKIHTQYMNIGEDVNLSEVSRLTEGKNGADLRAICMEAGMFAIRMERDAVNSEDFMKAIDKL 394          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METKA (Proteasome-activating nucleotidase OS=Methanopyrus kandleri GN=pan PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 6.196e-74
Identity = 132/234 (56.41%), Postives = 178/234 (76.07%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLES 707
            +E PL  PELF +VG++PPKGVLLYGPPGTGKTLLA+A+A++ DA F+++ +  ++ K+IGE ARL+RE+F  AR+  P IIF+DEIDAIG RR  + TS DRE+QRTL +LL ++DGFD L  +K+I ATNR D+LDPALLRPGR DR I+IPLP+E+ R EI KIH   +    ++D + + K+ EG +GAD++ +CTEAGM AIR +RD V  +DF+KAV ++   K+ ES
Sbjct:  195 VEKPLKEPELFEKVGVEPPKGVLLYGPPGTGKTLLAKAVANHADATFIRLAAPELVQKFIGEGARLVRELFELAREKAPSIIFIDEIDAIGARRMRDATSGDREVQRTLTQLLAEMDGFDPLDDIKVIAATNRKDILDPALLRPGRFDRHIKIPLPDEEGRYEIFKIHTRDMNLAEDVDLQKLAKITEGASGADIKAICTEAGMMAIREDRDIVTMDDFLKAVDRVMGKKEEES 428          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_PONAB (26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3)

HSP 1 Score: 277.33 bits (708), Expect = 8.093e-74
Identity = 128/226 (56.64%), Postives = 172/226 (76.11%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE F+ +GI+PPKGVLL+GPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRKIE  LP+ + R  ILKIHA  ++   +I +E + +L     GA++R+VCTEAGM AIRA R     +DF++AV K+
Sbjct:  191 VETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHILKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_SPIOL (26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 1.380e-73
Identity = 127/226 (56.19%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +ELP+++PE F+++GI PPKGVL YGPPGTGKTLLARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + CI+F DE+DAIGG RF +G   D E+QRT++E++NQLDGFD  G +K++MATNRPD LDPALLRPGRLDRK+E  LP+ + R +I KIH   +    +I +E + +L     GAD+R+VCTEAGM AIRA R  V  +DF+ AV K+
Sbjct:  184 VELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTQIFKIHTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKV 409          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_ORYSJ (26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 1.380e-73
Identity = 127/226 (56.19%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +ELP+++PE F+++GI PPKGVL YGPPGTGKTLLARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + CI+F DE+DAIGG RF +G   D E+QRT++E++NQLDGFD  G +K++MATNRPD LDPALLRPGRLDRK+E  LP+ + R +I KIH   +    +I +E + +L     GAD+R+VCTEAGM AIRA R  V  +DF+ AV K+
Sbjct:  184 VELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTQIFKIHTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKV 409          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METJA (Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii GN=pan PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.803e-73
Identity = 132/233 (56.65%), Postives = 179/233 (76.82%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLE 704
            +ELPL +PELF +VGI+PPKG+LLYGPPGTGKTLLA+A+A+  +A F++VV S ++ K+IGE A L++++F  A++  P IIF+DEIDAI  +R    T  DRE+QRTLM+LL ++DGFD  G VK+I ATNRPD+LDPA+LRPGR DR IE+P P+E+ R+EILKIH   +    +++ E + K+ EG  GA+L+ +CTEAGM+AIR  RDYV  +DF KAV K+ E KK++
Sbjct:  186 VELPLKHPELFEKVGIEPPKGILLYGPPGTGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIMEKKKVK 418          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PSMR_METTH2.972e-7658.97Proteasome-activating nucleotidase OS=Methanobacte... [more]
PRS7_PRUPE4.744e-7456.6426S protease regulatory subunit 7 OS=Prunus persic... [more]
PRS7A_ARATH4.744e-7456.6426S protease regulatory subunit 7 homolog A OS=Ara... [more]
PSMR_PYRHO6.196e-7456.10Proteasome-activating nucleotidase OS=Pyrococcus h... [more]
PSMR_METMJ6.196e-7461.67Proteasome-activating nucleotidase OS=Methanoculle... [more]
PSMR_METKA6.196e-7456.41Proteasome-activating nucleotidase OS=Methanopyrus... [more]
PRS7_PONAB8.093e-7456.6426S protease regulatory subunit 7 OS=Pongo abelii ... [more]
PRS7_SPIOL1.380e-7356.1926S protease regulatory subunit 7 OS=Spinacia oler... [more]
PRS7_ORYSJ1.380e-7356.1926S protease regulatory subunit 7 OS=Oryza sativa ... [more]
PSMR_METJA1.803e-7356.65Proteasome-activating nucleotidase OS=Methanocaldo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top