DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_PYRFU (Proteasome-activating nucleotidase OS=Pyrococcus furiosus GN=pan PE=3 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 2.355e-73
Identity = 137/246 (55.69%), Postives = 179/246 (72.76%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL--NEAKKLESSAHYNADFG 734
            +IELPL +PELF  VGI PPKGVLLYGPPG GKTL+A+AIA  ++A F++VV S ++ KYIGE ARL+ E+F  A++  P IIF+DEIDAIG +R  E T  +RE+ RTLM+LL ++DGFD  G VK+I ATNRPD+LDPALLRPGR DR IE+PLP+ + R+EILK+H   +   G +D   + +L EG +GADL+ + TEAGM AIR  R YV  EDF+KA+ K+  NE K ++    +   +G
Sbjct:  152 AIELPLKHPELFEEVGIDPPKGVLLYGPPGCGKTLMAKAIAHEVNATFIRVVGSELVRKYIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRLDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFEGRLEILKVHTRRMKLRG-VDLRLIAELTEGASGADLKAIATEAGMFAIRERRTYVTQEDFLKAIDKVLGNEKKIIQQIMSHEVIYG 396          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_XENLA (26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 2.355e-73
Identity = 127/226 (56.19%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE F+ +GI+PPKGVLL+GPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRKIE  LP+ + R  I KIHA  ++   +I +E + +L     GA++R+VCTEAGM AIRA R     +DF++AV K+
Sbjct:  191 VETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 416          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_MOUSE (26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5)

HSP 1 Score: 275.789 bits (704), Expect = 2.355e-73
Identity = 127/226 (56.19%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE F+ +GI+PPKGVLL+GPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRKIE  LP+ + R  I KIHA  ++   +I +E + +L     GA++R+VCTEAGM AIRA R     +DF++AV K+
Sbjct:  191 VETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_MACFA (26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3)

HSP 1 Score: 275.789 bits (704), Expect = 2.355e-73
Identity = 127/226 (56.19%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE F+ +GI+PPKGVLL+GPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRKIE  LP+ + R  I KIHA  ++   +I +E + +L     GA++R+VCTEAGM AIRA R     +DF++AV K+
Sbjct:  191 VETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_HUMAN (26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3)

HSP 1 Score: 275.789 bits (704), Expect = 2.355e-73
Identity = 127/226 (56.19%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE F+ +GI+PPKGVLL+GPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRKIE  LP+ + R  I KIHA  ++   +I +E + +L     GA++R+VCTEAGM AIRA R     +DF++AV K+
Sbjct:  191 VETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_BOVIN (26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3)

HSP 1 Score: 275.789 bits (704), Expect = 2.355e-73
Identity = 127/226 (56.19%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE F+ +GI+PPKGVLL+GPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRKIE  LP+ + R  I KIHA  ++   +I +E + +L     GA++R+VCTEAGM AIRA R     +DF++AV K+
Sbjct:  191 VETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_PYRAB (Proteasome-activating nucleotidase OS=Pyrococcus abyssi GN=pan PE=3 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 4.016e-73
Identity = 137/246 (55.69%), Postives = 179/246 (72.76%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL--NEAKKLESSAHYNADFG 734
            +IELPL +PELF  VGI PPKGVLLYGPPG GKTL+A+A+A  ++A F++VV S ++ KYIGE ARL+ E+F  A++  P IIF+DEIDAIG +R  E T  +RE+ RTLM+LL ++DGFD  G VK+I ATNRPD+LDPALLRPGR DR IE+PLP+ + R+EILK+H   + K   +D   + ++ EG +GADL+ + TEAGM AIR  R YV  EDF+KAV K+  NE K L+    +   +G
Sbjct:  155 AIELPLKHPELFEEVGIDPPKGVLLYGPPGCGKTLMAKALAHEVNATFIRVVGSELVRKYIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFEGRLEILKVHTRRM-KLKNVDLRVIAEITEGASGADLKAIATEAGMFAIRERRTYVTQEDFLKAVDKVLGNERKLLQQITSHEIIYG 399          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_RAT (26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3)

HSP 1 Score: 274.633 bits (701), Expect = 5.246e-73
Identity = 127/226 (56.19%), Postives = 170/226 (75.22%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE F+ +GI+PPKGVLL+GPPGTGKTL ARA+A+  DA F+ V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRKIE  LP+ + R  I KIHA  ++   +I +E + +L     GA++R+VCTEAGM AIRA R     +DF++AV K+
Sbjct:  191 VETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIPVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_DICDI (26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 5.246e-73
Identity = 130/243 (53.50%), Postives = 178/243 (73.25%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSA----HYN 722
            +E+PL++PE F+ +GI PPKGVL+YGPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++R++F  AR  + CIIF DE+DAIGG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPALLRPGRLDRK+E  LP+ + R  I  IHA  ++   +I +E + +L     GAD+R+VCTEAGM AIRA R  V  +DF++A+ K+ ++    S+     HYN
Sbjct:  186 VEMPLLHPEKFVNLGIDPPKGVLMYGPPGTGKTLCARAVANRTDAAFVRVIGSELVQKYVGEGARMVRDLFQMARSKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRAHIFTIHAKTMSCARDIRFELLARLCPNSTGADIRSVCTEAGMFAIRARRKVVSEKDFLEAIDKVIKSYAKFSATSRYMHYN 428          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_CAEEL (26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 5.246e-73
Identity = 125/226 (55.31%), Postives = 171/226 (75.66%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +E PL++PE ++ +GI+PPKGVLLYGPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + C+IF DEIDA+GG RF +G   D E+QRT++EL+NQLDGFD  G +K++MATNRPD LDPAL+RPGRLDRK+E  LP+   R  ILKIHA  ++   +I Y+ + +L     GA++R+VCTEAGM AIRA R     +DF++A+ K+
Sbjct:  193 VETPLLHPERYVNLGIEPPKGVLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIHAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKV 418          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PSMR_PYRFU2.355e-7355.69Proteasome-activating nucleotidase OS=Pyrococcus f... [more]
PRS7_XENLA2.355e-7356.1926S protease regulatory subunit 7 OS=Xenopus laevi... [more]
PRS7_MOUSE2.355e-7356.1926S protease regulatory subunit 7 OS=Mus musculus ... [more]
PRS7_MACFA2.355e-7356.1926S protease regulatory subunit 7 OS=Macaca fascic... [more]
PRS7_HUMAN2.355e-7356.1926S protease regulatory subunit 7 OS=Homo sapiens ... [more]
PRS7_BOVIN2.355e-7356.1926S protease regulatory subunit 7 OS=Bos taurus GN... [more]
PSMR_PYRAB4.016e-7355.69Proteasome-activating nucleotidase OS=Pyrococcus a... [more]
PRS7_RAT5.246e-7356.1926S protease regulatory subunit 7 OS=Rattus norveg... [more]
PRS7_DICDI5.246e-7353.5026S protease regulatory subunit 7 OS=Dictyostelium... [more]
PRS7_CAEEL5.246e-7355.3126S protease regulatory subunit 7 OS=Caenorhabditi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top