DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_THEON (Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.169e-72
Identity = 132/227 (58.15%), Postives = 174/227 (76.65%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +IELPL +PELF +VGI+PPKGVLLYGPPG GKTL+A+A+A  ++A F++VV S ++ K+IGE ARL+ E+F  A++  P IIF+DEIDAIG +R  E T  +RE+ RTLM+LL ++DGFD  G VK+I ATNRPD+LDPALLRPGR DR IE+PLPN +SR+EILKIH   +   G +D   + ++ EG +GADL+ +  EAGM AIR  R+YV  EDF+KA+ K+
Sbjct:  154 AIELPLKHPELFEKVGIEPPKGVLLYGPPGCGKTLMAKALAHEVNATFIRVVGSELVRKFIGEGARLVHELFELAKEKAPAIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPSGNVKIIAATNRPDILDPALLRPGRFDRLIEVPLPNFKSRLEILKIHTKRMNLKG-VDLRIIAEMTEGASGADLKAITMEAGMFAIRDRREYVTQEDFLKAIEKV 379          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_PYRKO (Proteasome-activating nucleotidase OS=Pyrococcus kodakaraensis GN=pan PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.169e-72
Identity = 132/232 (56.90%), Postives = 178/232 (76.72%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +IELPL +PELF +VGI+PPKGVLLYGPPG GKTL+A+A+A++++A F++VV S ++ K+IGE ARL+ E+F  A++  P IIF+DEIDAIG +R  E T  +RE+ RTLM+LL ++DGFD  G VK+I ATNRPD+LDPALLRPGR DR IE+PLP+ Q R+EILK+H   +   G +D   + ++ EG +GADL+ + TEAGM AIR  R YV  +DF+KAV K+  ++K
Sbjct:  153 AIELPLKHPELFEQVGIEPPKGVLLYGPPGCGKTLMAKAVANHVNATFIRVVGSELVRKFIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDYQGRLEILKVHTRKMNLKG-VDLRVIAEITEGASGADLKAIATEAGMFAIRDRRTYVTQDDFLKAVDKVIGSEK 383          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METMP (Proteasome-activating nucleotidase OS=Methanococcus maripaludis GN=pan PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.169e-72
Identity = 133/231 (57.58%), Postives = 175/231 (75.76%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +ELPL NPELF +VGI PPKGVLLYGPPGTGKTLLA+A+A   +A+F++VV S ++ K+IGE A+L+R++F  A++  PCIIF+DEIDA+  +R    T  DRE+QRTLM+LL ++DGFD  G VK+I ATNRPD+LDPA+LRPGR DR IEI +P+E  R+EILKIH   +   G +D   V K+AE   GADL+ VCTEAGM AIR ER+++  +DF +A+ K+   K+
Sbjct:  164 VELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLEILKIHTEKMNLKG-VDLREVAKIAENMVGADLKAVCTEAGMFAIREEREFIKMDDFREAISKITGKKE 393          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METM6 (Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.526e-72
Identity = 133/231 (57.58%), Postives = 175/231 (75.76%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +ELPL NPELF +VGI PPKGVLLYGPPGTGKTLLA+A+A   +A+F++VV S ++ K+IGE A+L+R++F  A++  PCIIF+DEIDA+  +R    T  DRE+QRTLM+LL ++DGFD  G VK+I ATNRPD+LDPA+LRPGR DR IEI +P+E  R++ILKIH   +   G +D   V KLAE   GADL+ VCTEAGM AIR ER+++  +DF +A+ K+   K+
Sbjct:  164 VELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLDILKIHTEKMNLKG-VDLREVAKLAENMVGADLKAVCTEAGMFAIREEREFIKMDDFKEAISKITGKKE 393          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_SCHPO (26S protease regulatory subunit 7 homolog OS=Schizosaccharomyces pombe GN=rpt1 PE=1 SV=2)

HSP 1 Score: 272.707 bits (696), Expect = 1.993e-72
Identity = 128/239 (53.56%), Postives = 177/239 (74.06%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEA-KKLESSAHY 719
            +ELPL++PE F+++GI PPKG++LYGPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + CIIF DEIDAIGG RF +G   D E+QRT++EL+ QLDGFD  G +K++ ATNRP+ LD AL+RPGR+DRK+E  LP+ + R  IL+IHA  +A   +I +E + +L     GA+LR+VCTEAGM AIRA R     +DF+ AV+K+ +  +K  S+A Y
Sbjct:  195 VELPLLSPERFVKLGIDPPKGIMLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVLFATNRPNTLDEALMRPGRIDRKVEFGLPDLEGRAHILRIHAKSMAIDKDIRWELIARLCPSQTGAELRSVCTEAGMFAIRARRRVATEKDFLDAVQKVVKGNQKFSSTADY 433          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METM5 (Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.603e-72
Identity = 132/231 (57.14%), Postives = 175/231 (75.76%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +ELPL NPELF +VGI PPKGVLLYGPPGTGKTLLA+A+A   +A+F++VV S ++ K+IGE A+L+R++F  A++  PCIIF+DEIDA+  +R    T  DRE+QRTLM+LL ++DGFD  G VK+I ATNRPD+LDPA+LRPGR DR IEI +P+E  R++ILKIH   +   G +D   V K+AE   GADL+ VCTEAGM AIR ER+++  +DF +A+ K+   K+
Sbjct:  164 VELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLDILKIHTEKMNLKG-VDLREVAKIAENMVGADLKAVCTEAGMFAIREEREFIKMDDFREAITKITGKKE 393          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7_YEAST (26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae GN=RPT1 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.603e-72
Identity = 128/239 (53.56%), Postives = 174/239 (72.80%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRK-LNEAKKLESSAHY 719
            +ELPL++PE F  +GI PPKG+LLYGPPGTGKTL ARA+A+  DA F++V+ S ++ KY+GE AR++RE+F  AR  + CIIF DEIDA+GG RF +G   D E+QRT++EL+ QLDGFD  G +K++ ATNRP+ LDPALLRPGR+DRK+E  LP+ + R  I +IH+  ++    I +E + +L     GA+LR+VCTEAGM AIRA R     +DF+KAV K ++  KK  S++ Y
Sbjct:  225 VELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRY 463          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METM7 (Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 3.400e-72
Identity = 133/231 (57.58%), Postives = 174/231 (75.32%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            +ELPL NPELF +VGI PPKGVLLYGPPGTGKTLLA+A+A   +A+F++VV S ++ K+IGE A+L+R++F  A++  PCIIF+DEIDA+  +R    T  DRE+QRTLM+LL ++DGFD  G VK+I ATNRPD+LDPA+LRPGR DR IEI +P+E  R+EILKIH   +     +D   V KLAE   GADL+ VCTEAGM AIR ER+++  +DF +A+ K+   K+
Sbjct:  164 VELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLEILKIHTEKM-NLKNVDLREVAKLAENMVGADLKAVCTEAGMFAIREEREFIKMDDFKEAISKITGKKE 393          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_THEGJ (Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 7.575e-72
Identity = 131/232 (56.47%), Postives = 176/232 (75.86%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            ++ELPL +PELF +VGI+PPKGVLLYGPPG GKTL+A+A+A++++A F++VV S ++ K+IGE ARL+ E+F  A++  P IIF+DEIDAIG +R  E T  +RE+ RTLM+LL ++DGFD  G VK+I ATNRPD+LDPALLRPGR DR IE+PLP+ + R+EILK+H   +     +D   +  + EG +GADL+ + TEAGM AIR  R YV  EDF+KAV K+  A+K
Sbjct:  153 AVELPLKHPELFEKVGIEPPKGVLLYGPPGCGKTLMAKAVANHVNATFIRVVGSELVRKFIGEGARLVHELFEMAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFRGRLEILKVHTRKMNLR-NVDLSIIADITEGASGADLKAIATEAGMFAIRDRRTYVTQEDFLKAVDKVLGAEK 383          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_SULTO (Proteasome-activating nucleotidase OS=Sulfolobus tokodaii GN=pan PE=3 SV=2)

HSP 1 Score: 268.47 bits (685), Expect = 3.759e-71
Identity = 134/242 (55.37%), Postives = 174/242 (71.90%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL----NEAKKLESSAHY 719
            IELPL NPELF  +GI PPKGVLLYGPPGTGKTLLA+A+A+  +A F++VV+S    K++GE AR++RE+F  AR   P I+F+DEIDAIG +R   GTS +REIQRTLM+LL ++DGF  L  VK+I ATNR D+LDPALLRPGR DR IE+PLPN + R EI +I+   +   G I Y+ +  + EGF+GA+++NVCTEAG  AIR  R YV   D + A+ K+    N+AK  + +  Y
Sbjct:  150 IELPLKNPELFKEIGIDPPKGVLLYGPPGTGKTLLAKAVATESNATFIQVVASEFAQKFVGEGARIVREVFELARRKAPSIVFIDEIDAIGAKRVDMGTSGEREIQRTLMQLLAEIDGFKPLDNVKIIAATNRLDILDPALLRPGRFDRLIEVPLPNFEGRKEIFRIYLQKMKTDGNIRYDILASMTEGFSGAEIKNVCTEAGYIAIRNGRKYVNMTDLITAIEKIKAKNNKAKNTDRTEKY 391          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PSMR_THEON1.169e-7258.15Proteasome-activating nucleotidase OS=Thermococcus... [more]
PSMR_PYRKO1.169e-7256.90Proteasome-activating nucleotidase OS=Pyrococcus k... [more]
PSMR_METMP1.169e-7257.58Proteasome-activating nucleotidase OS=Methanococcu... [more]
PSMR_METM61.526e-7257.58Proteasome-activating nucleotidase OS=Methanococcu... [more]
PRS7_SCHPO1.993e-7253.5626S protease regulatory subunit 7 homolog OS=Schiz... [more]
PSMR_METM52.603e-7257.14Proteasome-activating nucleotidase OS=Methanococcu... [more]
PRS7_YEAST2.603e-7253.5626S protease regulatory subunit 7 homolog OS=Sacch... [more]
PSMR_METM73.400e-7257.58Proteasome-activating nucleotidase OS=Methanococcu... [more]
PSMR_THEGJ7.575e-7256.47Proteasome-activating nucleotidase OS=Thermococcus... [more]
PSMR_SULTO3.759e-7155.37Proteasome-activating nucleotidase OS=Sulfolobus t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top