DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_ARCFU (Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus GN=pan PE=1 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 4.910e-71
Identity = 129/227 (56.83%), Postives = 171/227 (75.33%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            ++ELPL+ PELF  VGI+PPKGVLLYGPPGTGKTLLA+A+A+   A F++VV S  + KYIGE ARL+RE+F  A++  P IIF+DE+DAI  RR +  TS DRE+QRT+M+LL +LDGFD  G VK+I ATNR D+LDPA+LRPGR DR IE+PLP  + R++I KIH   +    ++D++ + ++ EG +GAD++ +CTEAGM AIR ER  V   DF KA+ K+
Sbjct:  156 AVELPLLKPELFAEVGIEPPKGVLLYGPPGTGKTLLAKAVANQTRATFIRVVGSEFVQKYIGEGARLVREVFQLAKEKAPSIIFIDELDAIAARRTNSDTSGDREVQRTMMQLLAELDGFDPRGDVKVIGATNRIDILDPAILRPGRFDRIIEVPLPTFEGRIQIFKIHTRKMKLAEDVDFKELARITEGASGADIKAICTEAGMFAIREERAKVTMLDFTKAIEKV 382          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METVS (Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 6.412e-71
Identity = 134/245 (54.69%), Postives = 176/245 (71.84%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL--NEAKKLESSAHYNADFG 734
            +ELPL NPELF +VGI PPKGVLLYGPPGTGKTLLA+A+A   +A+F++VV S ++ K+IGE A+L+R++F  A++  PCIIF+DEIDA+  +R    T  DRE+QRTLM+LL ++DGFD  G VK+I ATNRPD+LDPA+LRPGR DR IEI  P+E  R+EI KIH   +     +D   + K+AE   GAD++ VCTEAGM AIR  R+YV  +DF +A+ K+   + K  E  AH    +G
Sbjct:  164 VELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVARETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEIAAPDEDGRLEIFKIHTDKM-NIKSVDLREIAKMAENMVGADIKAVCTEAGMFAIREGREYVTTKDFKEALLKVTGKKEKSEEGIAHLTTMYG 407          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METB6 (Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 6.412e-71
Identity = 130/227 (57.27%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            ++ELPL  PELF ++GI+PPKGVLLYGPPGTGKTLLA+A+A   +A+F++VV S ++ KYIGE ARL+RE+F  A+   P IIF+DEIDA+G  R    TS DRE+QRTLM+LL  +DGF+  G VK+I ATNR D+LD ALLRPGR DR IEIPLP+E+ R+ ILK+H   +     ++   +  L EG NGADLR +C EAGM AIR ER  +  EDF+ A+ K+
Sbjct:  193 AVELPLKRPELFTQIGIEPPKGVLLYGPPGTGKTLLAKAVAHETNAHFMRVVGSELVQKYIGEGARLVRELFDLAKKKAPTIIFIDEIDAVGASRTEANTSGDREVQRTLMQLLAGMDGFETRGDVKIIGATNRIDILDKALLRPGRFDRIIEIPLPDEEGRLSILKVHTRTLTMEETVNLPEIAGLTEGKNGADLRAICMEAGMYAIRNERPAITREDFLSAIEKV 419          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS7B_ARATH (26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=3 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 8.375e-71
Identity = 129/241 (53.53%), Postives = 176/241 (73.03%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEA-KKLESSAHYNA 725
            +ELP+++PE F+R+GI PPKGVL YGPPG+GKTL+ARA+A+   A F++VV S ++ KYIGE AR++RE+F  AR  + CI+F DEIDAIGG RF +G  +D E+QRT++E+L QLDGFD  G +K++MATNRPD+LDPALLRPGRLDRK+E  LP+ + R +I KIH   ++   +I +E +  L     GAD+R+VC EAGM AI A R  V  +DF+ AV K+ +  +K  ++  Y A
Sbjct:  221 VELPMLHPEKFVRLGIDPPKGVLCYGPPGSGKTLVARAVANRTGACFIRVVGSELVQKYIGEGARMVRELFQMARSKKACILFFDEIDAIGGARFDDGVGSDNEVQRTMLEILYQLDGFDARGNIKVLMATNRPDILDPALLRPGRLDRKVEFCLPDLEGRTQIFKIHTRTMSCERDIRFELLAGLCPNSTGADIRSVCIEAGMYAIGARRKSVTEKDFLDAVNKVVKGYQKFSATPKYMA 461          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METAC (Proteasome-activating nucleotidase OS=Methanosarcina acetivorans GN=pan PE=3 SV=2)

HSP 1 Score: 265.003 bits (676), Expect = 4.156e-70
Identity = 124/230 (53.91%), Postives = 176/230 (76.52%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEA 692
            ++ELPL+ PE F R+GI+PPKGVLLYG PGTGKTLLA+A+A   +A F++VV S ++ KYIG+ ++L+RE+F  AR   P IIF+DE+D+I  RR +E T ADRE+QRTLM+LL ++DGFD+   +++I ATNRPDVLDPA+LRPGR DR + +P+P  ++R +ILKIH   +   G+ID++ + K+ EG +GADL+ + TEAGM A+R ++  V  EDF++AV K++ A
Sbjct:  174 AVELPLIEPERFARIGIEPPKGVLLYGLPGTGKTLLAKAVAHRTNATFIRVVGSELVQKYIGDGSKLVREIFEMARKKAPSIIFIDELDSIAARRLNETTGADREVQRTLMQLLAEMDGFDKRKNIRIIAATNRPDVLDPAILRPGRFDRLVHVPMPGIEARGKILKIHCGKMTLAGDIDFKKLAKVTEGMSGADLKAIATEAGMFAVRKDKALVEMEDFLEAVEKVSMA 403          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_MANSE (26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.063e-69
Identity = 127/226 (56.19%), Postives = 169/226 (74.78%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + +  F++V  S ++ K+IGE +R++RE+F  AR+H P IIFMDEID+IG  R   G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LDPALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  161 IELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 386          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_DROME (26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Pros45 PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 2.063e-69
Identity = 127/226 (56.19%), Postives = 169/226 (74.78%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + +  F++V  S ++ K+IGE +R++RE+F  AR+H P IIFMDEID+IG  R   G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LDPALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  164 IELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 389          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_RAT (26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.519e-69
Identity = 128/226 (56.64%), Postives = 168/226 (74.34%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ K+IGE AR++RE+F  AR+H P IIFMDEID+IG  R   G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LD ALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  165 IELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_PIG (26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.519e-69
Identity = 128/226 (56.64%), Postives = 168/226 (74.34%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ K+IGE AR++RE+F  AR+H P IIFMDEID+IG  R   G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LD ALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  165 IELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_MOUSE (26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.519e-69
Identity = 128/226 (56.64%), Postives = 168/226 (74.34%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ K+IGE AR++RE+F  AR+H P IIFMDEID+IG  R   G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LD ALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  165 IELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 390          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PSMR_ARCFU4.910e-7156.83Proteasome-activating nucleotidase OS=Archaeoglobu... [more]
PSMR_METVS6.412e-7154.69Proteasome-activating nucleotidase OS=Methanococcu... [more]
PSMR_METB66.412e-7157.27Proteasome-activating nucleotidase OS=Methanoregul... [more]
PRS7B_ARATH8.375e-7153.5326S protease regulatory subunit 7 homolog B OS=Ara... [more]
PSMR_METAC4.156e-7053.91Proteasome-activating nucleotidase OS=Methanosarci... [more]
PRS8_MANSE2.063e-6956.1926S protease regulatory subunit 8 OS=Manduca sexta... [more]
PRS8_DROME2.063e-6956.1926S protease regulatory subunit 8 OS=Drosophila me... [more]
PRS8_RAT3.519e-6956.6426S protease regulatory subunit 8 OS=Rattus norveg... [more]
PRS8_PIG3.519e-6956.6426S protease regulatory subunit 8 OS=Sus scrofa GN... [more]
PRS8_MOUSE3.519e-6956.6426S protease regulatory subunit 8 OS=Mus musculus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top