DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_HUMAN (26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.979e-68
Identity = 119/223 (53.36%), Postives = 168/223 (75.34%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKA 671
            S+ELPL +PE +  +GIKPPKGV+LYGPPGTGKTLLA+A+A+   A FL+VV S +I KY+G+  +L+RE+F  A +H P I+F+DEIDAIG +R+   +  +REIQRT++ELLNQLDGFD  G VK+IMATNR + LDPAL+RPGR+DRKIE PLP+E+++  I +IH + +    ++  + ++   +  +GAD++ +CTEAG+ A+R  R  V +EDF K+
Sbjct:  200 SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKS 422          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_DROME (26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Pros26.4 PE=1 SV=2)

HSP 1 Score: 258.84 bits (660), Expect = 2.979e-68
Identity = 120/232 (51.72%), Postives = 170/232 (73.28%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            S+ELPL +PE +  +GIKPPKGV+LYGPPGTGKTLLA+A+A+   A FL+VV S +I KY+G+  +L+RE+F  A +H P I+F+DEIDA+G +R+   +  +REIQRT++ELLNQLDGFD  G VK+IMATNR + LDPAL+RPGR+DRKIE PLP+E+++  I  IH + +    +++   ++   +  +GAD++ +CTEAG+ A+R  R  V +EDF K+   +   KK
Sbjct:  199 SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKK 430          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_CHICK (26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.979e-68
Identity = 119/223 (53.36%), Postives = 168/223 (75.34%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKA 671
            S+ELPL +PE +  +GIKPPKGV+LYGPPGTGKTLLA+A+A+   A FL+VV S +I KY+G+  +L+RE+F  A +H P I+F+DEIDAIG +R+   +  +REIQRT++ELLNQLDGFD  G VK+IMATNR + LDPAL+RPGR+DRKIE PLP+E+++  I +IH + +    ++  + ++   +  +GAD++ +CTEAG+ A+R  R  V +EDF K+
Sbjct:  200 SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHGPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKS 422          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_UNCMA (Proteasome-activating nucleotidase OS=Uncultured methanogenic archaeon RC-I GN=pan PE=3 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 3.890e-68
Identity = 122/227 (53.74%), Postives = 168/227 (74.01%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            ++ELPL+ PELF +VGI+PPKGVLLYGPPGTGKTLLA+A+A+   A F++++ S ++ KYIGE AR++RE+F  A++  P IIF+DEID+IG +R    TS DRE+QRTL++LL ++DGFD  G V+++ ATNRPD+LDPALLRPGR DR I++P+P  ++R +ILKIHA  +    ++D   +  + +  +GADL  +  EAGM AIR  RD V   DF  AV K+
Sbjct:  174 TVELPLLKPELFQKVGIEPPKGVLLYGPPGTGKTLLAKAVANRTKATFIRIIGSELVQKYIGEGARMVRELFELAKEKSPSIIFIDEIDSIGAKRLDSITSGDREVQRTLVQLLAEMDGFDPRGNVRILAATNRPDILDPALLRPGRFDRMIKVPMPTAEAREQILKIHARKMNLADDVDLRKIALITDESSGADLSAIVMEAGMFAIRNNRDVVDSSDFNAAVAKV 400          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_AERPE (Proteasome-activating nucleotidase OS=Aeropyrum pernix GN=pan PE=3 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 3.890e-68
Identity = 126/230 (54.78%), Postives = 169/230 (73.48%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEA 692
            ++ LP+ NP LF  +GI PPKGVLL+GPPGTGKTLLA+A+A   +A F++VV S +++K+IGE ARL+RE+F  AR+  P I+F+DEIDAI  +R   GTS DRE+QRT+++LL +LDGFD L  VK+I ATNR D++DPA+LRPGR DR IE+PLP+ + R+EIL IH        ++D EA+ KL EGF+GADL+ V  EAG +AIR     +  +D +KAV K+  A
Sbjct:  154 AVVLPIKNPHLFRELGIDPPKGVLLHGPPGTGKTLLAKAVAGETEATFIRVVGSELVNKFIGEGARLVREIFRLAREKAPSILFIDEIDAIASKRVDIGTSGDREVQRTMLQLLAELDGFDPLDNVKVIAATNRLDLIDPAVLRPGRFDRIIEVPLPSLRGRLEILGIHTRKAKMAPDVDLEAIAKLTEGFSGADLKAVVVEAGYNAIRRGSRVITMDDMIKAVEKVKAA 383          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PSMR_METPE (Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 6.636e-68
Identity = 126/228 (55.26%), Postives = 167/228 (73.25%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLN 686
            ++ELPL  PE+F ++GI+PPKGVLL+GPPGTGKTLLARA+A   +A+FL+VV S ++ KYIGE ARL+RE+F  A+   P IIF+DEIDAIG  R    TS DRE+ RTLM+LL ++DGF   G V++I ATNR D+LD ALLRPGR DR IEIP P+ + R+ IL IH AG+    ++D   +    +G NGADLR++C EAGM AIR++ + V  EDF +++ K +
Sbjct:  168 AVELPLKKPEVFRKMGIEPPKGVLLHGPPGTGKTLLARAVAHQTEAHFLRVVGSELVQKYIGEGARLVRELFELAKKKSPSIIFIDEIDAIGASRTESNTSGDREVHRTLMQLLAEMDGFSNRGDVRIIGATNRIDILDRALLRPGRFDRIIEIPAPDIEGRVSILNIHCAGMNIDKKVDIRDIATRTDGKNGADLRSICMEAGMFAIRSDHEMVTLEDFEQSIEKFS 395          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4B_ARATH (26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 8.666e-68
Identity = 124/232 (53.45%), Postives = 171/232 (73.71%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            ++ELPL +PEL+  +GIKPPKGV+LYG PGTGKTLLA+A+A++  A FL+VV S +I KY+G+  +L+RE+F  A D  P I+F+DEIDA+G +R+   +  +REIQRT++ELLNQLDGFD  G VK+I+ATNR + LDPALLRPGR+DRKIE PLP+ ++R  I +IH + +    +++ E  V   + F+GAD++ +CTEAG+ A+R  R  V H DF KA  K+   KK
Sbjct:  203 AVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHVDFKKAKEKVMFKKK 434          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4A_ARATH (26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 8.666e-68
Identity = 124/232 (53.45%), Postives = 171/232 (73.71%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            ++ELPL +PEL+  +GIKPPKGV+LYG PGTGKTLLA+A+A++  A FL+VV S +I KY+G+  +L+RE+F  A D  P I+F+DEIDA+G +R+   +  +REIQRT++ELLNQLDGFD  G VK+I+ATNR + LDPALLRPGR+DRKIE PLP+ ++R  I +IH + +    +++ E  V   + F+GAD++ +CTEAG+ A+R  R  V H DF KA  K+   KK
Sbjct:  203 AVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHPDFKKAKEKVMFKKK 434          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_XENLA (26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 4.301e-67
Identity = 127/226 (56.19%), Postives = 167/226 (73.89%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PE F  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ K+IGE AR++RE+F  AR+H P IIFMDEID+IG R    G+  D E+QRT++ELLNQLDGF+    +K+IMATNR D+LD ALLRPGR+DRKIE P PNE++R++ILKIH+  +     I+   + +L  G +GA+++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  160 IELPVKHPEHFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSR-LEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKV 384          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_ORYSJ (26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2)

HSP 1 Score: 254.603 bits (649), Expect = 5.617e-67
Identity = 122/232 (52.59%), Postives = 171/232 (73.71%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            ++ELPL +PEL+  +GI+PPKGV+LYG PGTGKTLLA+A+A++  A FL+VV S +I KY+G+  +L+RE+F  A +  P I+F+DEIDA+G +R+   +  +REIQRT++ELLNQLDGFD  G VK+I+ATNR + LDPALLRPGR+DRKIE PLP+ ++R  I +IH + +    +++ E  V   + F+GAD++ +CTEAG+ A+R  R  V H DF KA  K+   KK
Sbjct:  208 AVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMFKKK 439          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PRS4_HUMAN2.979e-6853.3626S protease regulatory subunit 4 OS=Homo sapiens ... [more]
PRS4_DROME2.979e-6851.7226S protease regulatory subunit 4 OS=Drosophila me... [more]
PRS4_CHICK2.979e-6853.3626S protease regulatory subunit 4 OS=Gallus gallus... [more]
PSMR_UNCMA3.890e-6853.74Proteasome-activating nucleotidase OS=Uncultured m... [more]
PSMR_AERPE3.890e-6854.78Proteasome-activating nucleotidase OS=Aeropyrum pe... [more]
PSMR_METPE6.636e-6855.26Proteasome-activating nucleotidase OS=Methanosphae... [more]
PRS4B_ARATH8.666e-6853.4526S proteasome regulatory subunit 4 homolog B OS=A... [more]
PRS4A_ARATH8.666e-6853.4526S proteasome regulatory subunit 4 homolog A OS=A... [more]
PRS8_XENLA4.301e-6756.1926S protease regulatory subunit 8 OS=Xenopus laevi... [more]
PRS4_ORYSJ5.617e-6752.5926S protease regulatory subunit 4 homolog OS=Oryza... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top