DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_SOLLC (26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 2.135e-66
Identity = 121/239 (50.63%), Postives = 173/239 (72.38%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            +I LP+ + E F ++G++PPKGVLLYGPPGTGKTL+ARA A+  +A FLK+    ++  +IG+ A+L+R+ F  A++  PCIIF+DEIDAIG +RF    S DRE+QRT++ELLNQLDGF    ++K+I ATNR D+LDPAL+R GRLDRKIE P P E++R  IL+IH+  +  + ++++E + +  + FNGA L+ VC EAGM A+R +   V HEDF + + ++ +AKK  S  +Y
Sbjct:  185 AIVLPMTHQERFQKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKSPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDDRIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVNPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIIQV-QAKKKASLNYY 422          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_ORYSJ (26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2)

HSP 1 Score: 252.677 bits (644), Expect = 2.135e-66
Identity = 122/241 (50.62%), Postives = 174/241 (72.20%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNA 725
            +I LP+ + + F ++GI+PPKGVLLYGPPGTGKTL+ARA A+  +A FLK+    ++  +IG+ A+L+R+ F  A++  PCIIF+DEIDAIG +RF    S DRE+QRT++ELLNQLDGF    ++K+I ATNR D+LDPAL+R GRLDRKIE P P+E++R  IL+IH+  +  + ++++E + +  + FNGA L+ VC EAGM A+R +   V HEDF + + ++   KK  SS +Y A
Sbjct:  191 AIVLPMTHKDRFQKLGIRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKSPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPSEEARARILQIHSRKMNVNPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIIQVQAKKK--SSLNYYA 429          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_YEAST (26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae GN=RPT6 PE=1 SV=4)

HSP 1 Score: 251.521 bits (641), Expect = 4.755e-66
Identity = 125/226 (55.31%), Postives = 163/226 (72.12%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGV+LYGPPGTGKTLLARA+A + D  F++V  + ++ KYIGE +R++RE+F  AR+H P IIFMDEID+IG  R       D E+QRT++ELLNQLDGF+    +K+IMATNR D+LDPALLRPGR+DRKIE P P+  +R EIL+IH+  +     I+   V +   G +GAD++ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  164 IELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKV 389          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PS6AB_ARATH (26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3)

HSP 1 Score: 251.136 bits (640), Expect = 6.211e-66
Identity = 122/239 (51.05%), Postives = 173/239 (72.38%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            +I LP+ + E F ++GI+PPKGVLLYGPPGTGKTL+ARA A+  +A FLK+    ++  +IG+ A+L+R+ F  A++  PCIIF+DEIDAIG +RF    S DRE+QRT++ELLNQLDGF    ++K+I ATNR D+LDPAL+R GRLDRKIE P P E++R  IL+IH+  +  + ++++E + +  + FNGA L+ VC EAGM A+R +   V HEDF + + ++ +AKK  S  +Y
Sbjct:  185 AIVLPMTHKEQFEKLGIRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFLLAKEKSPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDDRIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARGRILQIHSRKMNVNADVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQV-QAKKKASLNYY 422          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_DICDI (26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 1.059e-65
Identity = 125/227 (55.07%), Postives = 164/227 (72.25%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSA-DREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGVLLYGPPGTGKTLLARA+A + D  F++V  S ++ KYIGE +R++RE+F  AR+H P IIFMDEID+IG  R   G+   D E+QRT++ELLNQLDGF+    +K++M TNR D+LDPALLRPGR+DRKIE P P +  R++ILKIH+  +     I+ + +     G +GA+L+ VCTEAGM A+R  R +V  EDF  AV K+
Sbjct:  161 IELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRGESGSGGGDSEVQRTMLELLNQLDGFESTKNIKVLMCTNRIDILDPALLRPGRIDRKIEFPNPGDAGRLDILKIHSRKMNLTRGINLKKISDKMNGASGAELKAVCTEAGMYALRERRVHVSQEDFEMAVSKV 387          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS8_NAEFO (26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.384e-65
Identity = 123/227 (54.19%), Postives = 164/227 (72.25%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSA-DREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            IELP+ +PELF  +GI  PKGV++YGPPGTGKTLLARA+A + D  F++V  S ++ KYIGE ++++RE+F  AR+H P IIFMDEID+IG  R   G    D E+QRT++ELLNQLDGF+    +K+IMATNR D+LDPALLRPGR+DRKIE P PNE +R++ILKIH+  +     I+   +  +  G +GA+++  CTEAGM A+R  R +V  ED   AV K+
Sbjct:  172 IELPIKHPELFESLGIAQPKGVIMYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSKMVRELFVMAREHAPSIIFMDEIDSIGSTRTEGGKGGGDSEVQRTMLELLNQLDGFESTQNIKIIMATNRIDILDPALLRPGRIDRKIEFPNPNELARLDILKIHSRRMNLTRGINLRKIASMLGGASGAEIKATCTEAGMFALRERRVHVTQEDLEMAVAKV 398          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_DICDI (26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 3.082e-65
Identity = 119/227 (52.42%), Postives = 167/227 (73.57%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKL 683
            +IELPL +PEL+  +GIKPPKGV+LYG PGTGKTLLA+A+A+   A FL+VV S +I KY+G+  +L+RE+F  A +  P I+F+DEIDA+G +R+   +  +REIQRT++ELLNQLDGFD    VK+IMATNR + LDPAL+RPGR+DRKIE PLP+ +++ +I +IH A +    +++ E  V   +  +GAD++ +CTE+G+ A+R  R  V H DF KA  K+
Sbjct:  199 AIELPLTHPELYEEIGIKPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADECAPSIVFIDEIDAVGTKRYDSQSGGEREIQRTMLELLNQLDGFDARTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEIHTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKV 425          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_ENCCU (26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi GN=RPT2 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.258e-65
Identity = 120/237 (50.63%), Postives = 170/237 (71.73%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSA 713
            S+ELPL NPEL+  +GIKPPKGV+LYG PGTGKTLLA+A+A+   A FL+VV + +I +Y+GE  +L+RE+F  A  H P IIF+DEIDAIGG+R++  +   RE+QRT++ELLNQLDGFD    +K+IMATN+ + LDPAL+RPGR+DRKIE  +P+  ++ +I  IH + +     ++ E ++   E  +GAD++ +CTEAGM A+R  R  V  +DF+ A  K+  +K+   SA
Sbjct:  184 SVELPLTNPELYQEMGIKPPKGVILYGLPGTGKTLLAKAVANQTSATFLRVVGTELIQEYLGEGPKLVRELFRVADMHAPSIIFIDEIDAIGGKRYNTSSGGRREVQRTMLELLNQLDGFDTRNDIKVIMATNKIEALDPALIRPGRIDRKIEFGMPDAATKKKIFDIHTSRMTLDESVNIELLITSKEDLSGADIKAICTEAGMIALRERRKTVTMKDFISAREKVFFSKQKMVSA 420          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS4_CAEEL (Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.258e-65
Identity = 115/232 (49.57%), Postives = 169/232 (72.84%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            ++ELPL +PE +  +GI+PPKGV+LYG PGTGKTLLA+A+A+   A FL++V S +I KY+G+  +++RE+F  A ++ P I+F+DEIDA+G +R+   +  +REIQRT++ELLNQLDGFD  G VK++MATNR + LDPAL+RPGR+DRKIE PLP+E+++  I +IH + +    E++ E  +   +  +GAD++ +CTEAG+ A+R  R  V  EDF K+   +   KK
Sbjct:  203 AVELPLTHPEYYEEMGIRPPKGVILYGCPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKMVRELFRVAEENAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVLMATNRIESLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTLGKEVNLEEFITAKDELSGADIKAMCTEAGLLALRERRMRVTMEDFQKSKENVLYRKK 434          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS6A_DICDI (26S protease regulatory subunit 6A homolog OS=Dictyostelium discoideum GN=psmC3 PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.998e-64
Identity = 117/232 (50.43%), Postives = 166/232 (71.55%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK 698
            ++ LP+ + E F  +GIKPPKGVL+YGPPGTGKTLLARA A+  ++ +LK+    ++  +IG+ A+L+R+ F  A++  P IIF+DE+DAIG +RF    S DRE+QRT++ELLNQLDGF     +K+I ATNR D+LDPALLR GRLDRKIE PLPNE++R  IL+IH+  +    +++++ + + +E FNGA L+ VC EAGM A+R     +IH DF++   ++   KK
Sbjct:  183 AVVLPMTHKERFESIGIKPPKGVLMYGPPGTGKTLLARACAAQTNSTYLKLAGPQLVQMFIGDGAKLVRDAFALAKEKGPTIIFIDELDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDANIKVIAATNRIDILDPALLRSGRLDRKIEFPLPNEEARAHILQIHSRKMNVSADVNFDELARSSEDFNGAQLKAVCVEAGMIALRRGGTELIHNDFVEGCVEVMAKKK 414          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PRS6A_SOLLC2.135e-6650.6326S protease regulatory subunit 6A homolog OS=Sola... [more]
PRS6A_ORYSJ2.135e-6650.6226S protease regulatory subunit 6A homolog OS=Oryz... [more]
PRS8_YEAST4.755e-6655.3126S protease regulatory subunit 8 homolog OS=Sacch... [more]
PS6AB_ARATH6.211e-6651.0526S protease regulatory subunit 6A homolog B OS=Ar... [more]
PRS8_DICDI1.059e-6555.0726S protease regulatory subunit 8 OS=Dictyostelium... [more]
PRS8_NAEFO1.384e-6554.1926S protease regulatory subunit 8 homolog OS=Naegl... [more]
PRS4_DICDI3.082e-6552.4226S protease regulatory subunit 4 homolog OS=Dicty... [more]
PRS4_ENCCU5.258e-6550.6326S protease regulatory subunit 4 homolog OS=Encep... [more]
PRS4_CAEEL5.258e-6549.57Probable 26S protease regulatory subunit 4 OS=Caen... [more]
PRS6A_DICDI1.998e-6450.4326S protease regulatory subunit 6A homolog OS=Dict... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top