DC900088

Overview
NameDC900088
Unique NameDC900088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1103
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2287 contig Csv1_Contig2287:180..1282. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_XENTR (Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 3.981e-100
Identity = 180/323 (55.73%), Postives = 230/323 (71.21%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHY-HQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F + SA+L LG +  AI+  R  TVQ +SGTGSLRVGA FL R Y +   +Y+P+P+WGNH  +F  AGL VK YRYYDP T G +F G L+D+   P  +I+L HACAHNPTGVDP  EQW+++  L++S+ L PFFD AYQGFASG  + DA +VR F+ +G   +++QSYAKNMGLYGERVGA ++VC   + A RVESQLK++IRPMYS+PP++GA I A IL    + KEW  E+K MA+RIISMR+QL   L   G+  +W HI  QIGMF FTGL  EQV  + KE+ IYMT DGRIS+AG++S    +L  AIH
Sbjct:  101 EFARASAQLALGENCDAIQSGRFITVQTISGTGSLRVGANFLQRFYKYSRDVYLPKPSWGNHTPIFRDAGLEVKGYRYYDPKTCGFDFTGALDDISKIPEQSIILFHACAHNPTGVDPKQEQWKELAALIKSRRLFPFFDMAYQGFASGDTNRDAWAVRHFIQEGINVVLSQSYAKNMGLYGERVGAFTVVCSDAEEAKRVESQLKILIRPMYSNPPLNGARIAAAILTQPDLRKEWLQEVKGMANRIISMREQLVSNLKKEGSIHNWQHISDQIGMFCFTGLRPEQVERLIKEFSIYMTKDGRISVAGVTSANNGYLAHAIH 423          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_RAT (Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Got2 PE=1 SV=2)

HSP 1 Score: 363.999 bits (933), Expect = 8.870e-100
Identity = 178/323 (55.11%), Postives = 228/323 (70.59%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            DF K SA+L LG +S  +K  R  TVQ +SGTG+LRVGA FL R +     +++P+P+WGNH  +F  AG+ ++ YRYYDP T G +F G LED+   P  +++LLHACAHNPTGVDP  EQW+++  +++ K L  FFD AYQGFASG  D DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  + A RVESQLK++IRP+YS+PP++GA I ATIL    + K+W  E+K MADRIISMR QL   L   G+  +W HI  QIGMF FTGL  EQV  +TKE+ +YMT DGRIS+AG++S  V +L  AIH
Sbjct:  104 DFCKASAELALGENSEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEMAAVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIH 426          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_MOUSE (Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.976e-99
Identity = 177/323 (54.80%), Postives = 228/323 (70.59%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F K SA+L LG ++  +K  R  TVQ +SGTG+LRVGA FL R +     +++P+P+WGNH  +F  AG+ ++ YRYYDP T G +F G LED+   P  +++LLHACAHNPTGVDP  EQW++I  +++ K L  FFD AYQGFASG  D DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  + A RVESQLK++IRP+YS+PP++GA I ATIL    + K+W  E+K MADRIISMR QL   L   G+  +W HI  QIGMF FTGL  EQV  +TKE+ +YMT DGRIS+AG++S  V +L  AIH
Sbjct:  104 EFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIH 426          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_BOVIN (Aspartate aminotransferase, mitochondrial OS=Bos taurus GN=GOT2 PE=1 SV=2)

HSP 1 Score: 361.688 bits (927), Expect = 4.402e-99
Identity = 175/323 (54.18%), Postives = 230/323 (71.21%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F K SA+L LG ++  +K  R  TVQ +SGTG+LR+GA FL R +     +++P+PTWGNH  +F  AG+ +++YRYYDP T G +F G +ED+   P+ +++LLHACAHNPTGVDP  EQW+++  +++   L  FFD AYQGFASG  + DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  + A RVESQLK++IRPMYS+PPI+GA I +TIL    + K+W  E+K MADRIISMR QL   L   G+  +W HII QIGMF +TGL  EQV  +TKE+ IYMT DGRIS+AG++S  V +L  AIH
Sbjct:  104 EFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGAIEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATVVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPMYSNPPINGARIASTILTSPDLRKQWLHEVKGMADRIISMRTQLVSNLKKEGSSHNWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVAYLAHAIH 426          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_HORSE (Aspartate aminotransferase, mitochondrial OS=Equus caballus GN=GOT2 PE=1 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 7.509e-99
Identity = 179/323 (55.42%), Postives = 225/323 (69.66%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F K SA+L LG +S A+K  R  TVQ +SGTG+LR+GA FL R +     +++P+P+WGNH  +F  AGL +  YRYYDP T G +  G LED+   P  +I+LLHACAHNPTGVDP  EQW++I  L++   L  FFD AYQGFASG  + DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  D A RVESQLK++IRP+YS+PP++GA I +TIL    + K+W  E+K MADRIISMR QL   L   G+   W HI  QIGMF FTGL  EQV  +TKE+ IYMT DGRIS+AG++S  V +L  AIH
Sbjct:   75 EFCKASAELALGENSEALKSGRYVTVQSISGTGALRIGANFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGLQLHAYRYYDPKTCGFDVTGALEDISKIPQQSIILLHACAHNPTGVDPRPEQWKEIATLVKKNNLFAFFDMAYQGFASGDGNKDAWAVRYFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPLYSNPPLNGARIASTILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHSWQHIADQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIH 397          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_PIG (Aspartate aminotransferase, mitochondrial OS=Sus scrofa GN=GOT2 PE=1 SV=2)

HSP 1 Score: 359.377 bits (921), Expect = 2.185e-98
Identity = 173/323 (53.56%), Postives = 229/323 (70.90%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F K SA+L LG ++  +K  R  TVQ +SGTG+LR+GA FL R +     +++P+P+WGNH  +F  AG+ + +YRYYDP T G +F G LED+   P+ +++LLHACAHNPTGVDP  EQW+++  L++   L  FFD AYQGFASG  + DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  + A RVESQLK++IRPMYS+PP++GA I +TIL    + ++W  E+K MADRIISMR QL   L   G+  +W HI+ QIGMF FTG+  EQV  +TKE+ IYMT DGRIS+AG++S  V +L  AIH
Sbjct:  104 EFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGANFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLHSYRYYDPKTCGFDFTGALEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATLVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPMYSNPPVNGARIASTILTSPDLRQQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHIVDQIGMFCFTGIKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIH 426          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_MACFA (Aspartate aminotransferase, mitochondrial OS=Macaca fascicularis GN=GOT2 PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 2.185e-98
Identity = 176/323 (54.49%), Postives = 226/323 (69.97%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F K SA+L LG +S  +K  R  TVQ +SGTG+LR+GA FL R +     +++P+P+WGNH  +F  AG+ ++ YRYYDP T G +F G +ED+   P  +++LLHACAHNPTGVDP  EQW++I  +++ + L  FFD AYQGFASG  D DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  D A RVESQLK++IRPMYS+PP++GA I A IL    + K+W  E+K MADRII MR QL   L   G+  +W HI  QIGMF FTGL  EQV  +TKE+ IYMT DGRIS+AG++S  V +L  AIH
Sbjct:  104 EFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIH 426          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_HUMAN (Aspartate aminotransferase, mitochondrial OS=Homo sapiens GN=GOT2 PE=1 SV=2)

HSP 1 Score: 359.377 bits (921), Expect = 2.185e-98
Identity = 176/323 (54.49%), Postives = 225/323 (69.66%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F K SA+L LG +S  +K  R  TVQ +SGTG+LR+GA FL R +     +++P+PTWGNH  +F  AG+ ++ YRYYDP T G +F G +ED+   P  +++LLHACAHNPTGVDP  EQW++I  +++ + L  FFD AYQGFASG  D DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  D A RVESQLK++IRPMYS+PP++GA I A IL    + K+W  E+K MADRII MR QL   L   G+  +W HI  QIGMF FTGL  EQV  + KE+ IYMT DGRIS+AG++S  V +L  AIH
Sbjct:  104 EFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIH 426          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_PONAB (Aspartate aminotransferase, mitochondrial OS=Pongo abelii GN=GOT2 PE=2 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 6.356e-98
Identity = 175/323 (54.18%), Postives = 225/323 (69.66%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            +F K SA+L LG +S  +K  R  TVQ +SGTG+LR+GA FL R +     +++P+P+WGNH  +F  AG+ ++ YRYYDP T G +F G +ED+   P  +++LLHACAHNPTGVDP  EQW++I  +++ + L  FFD AYQGFASG  D DA +VR F+  G    + QSYAKNMGLYGERVGA ++VCK  D A RVESQLK++IRPMYS+PP++GA I A IL    + K+W  E+K MADRII MR QL   L   G+  +W HI  QIGMF FTGL  EQV  + KE+ IYMT DGRIS+AG++S  V +L  AIH
Sbjct:  104 EFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIH 426          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_CHICK (Aspartate aminotransferase, cytoplasmic OS=Gallus gallus GN=GOT1 PE=1 SV=3)

HSP 1 Score: 353.599 bits (906), Expect = 1.199e-96
Identity = 175/334 (52.40%), Postives = 234/334 (70.06%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   ++++ LG DSPAI   RV +VQ L GTG+LR+GAEFL R Y+        +Y+  PTW NH  VF  AG   ++TYRY+D A RGL+ QGLL+D+  AP  +I +LHACAHNPTG DPT ++W+QI  +M+ + L PFFDSAYQGFASGSLD DA +VR FV++G E   AQS++KN GLY ERVG LS+V K ED   RV SQ++ ++R  +S+PP  GA IVAT L    ++ EW   +K MADR++ MR +L   L + GTPG W+HI  QIGMF+FTGLN +QV +M KE HIY+ + GRI+M GL++K + ++  +IH AVT++
Sbjct:   78 EFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFLRRWYNGNNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKRGLDLQGLLDDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGSLDKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNLDYVAKSIHEAVTKI 411          
The following BLAST results are available for this feature:
BLAST of DC900088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
AATM_XENTR3.981e-10055.73Aspartate aminotransferase, mitochondrial OS=Xenop... [more]
AATM_RAT8.870e-10055.11Aspartate aminotransferase, mitochondrial OS=Rattu... [more]
AATM_MOUSE1.976e-9954.80Aspartate aminotransferase, mitochondrial OS=Mus m... [more]
AATM_BOVIN4.402e-9954.18Aspartate aminotransferase, mitochondrial OS=Bos t... [more]
AATM_HORSE7.509e-9955.42Aspartate aminotransferase, mitochondrial OS=Equus... [more]
AATM_PIG2.185e-9853.56Aspartate aminotransferase, mitochondrial OS=Sus s... [more]
AATM_MACFA2.185e-9854.49Aspartate aminotransferase, mitochondrial OS=Macac... [more]
AATM_HUMAN2.185e-9854.49Aspartate aminotransferase, mitochondrial OS=Homo ... [more]
AATM_PONAB6.356e-9854.18Aspartate aminotransferase, mitochondrial OS=Pongo... [more]
AATC_CHICK1.199e-9652.40Aspartate aminotransferase, cytoplasmic OS=Gallus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900088 VSS Citrus sinensis cDNA clone VS27V02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900088 ID=DC900088|Name=DC900088|organism=Citrus sinensis|type=EST|length=1103bp
GATTTTAATAAATTGAGTGCAAAGCTCATCCTTGGTGCTGACAGCCCTGC
GATTAAAGACAACAGAGTGACCACCGTTCAGTGCTTGTCTGGCACTGGTT
CTTTGAGGGTTGGAGCTGAGTTTCTGGCAAGGCATTATCACCAACTTACC
ATATATATTCCACAGCCAACATGGGGAAACCATCCCAAAGTTTTCACTTT
AGCAGGATTGTCTGTGAAGACCTACCGCTATTATGATCCAGCAACACGTG
GGCTAAACTTCCAAGGCTTGCTGGAGGATCTTAGGGCTGCACCATCCGGA
GCTATAGTTCTTCTTCATGCATGTGCTCATAATCCAACTGGTGTTGACCC
GACCCTTGAGCAGTGGGAGCAGATCAGGCAGCTGATGAGGTCAAAAGGAT
TGTTACCTTTCTTTGACAGTGCTTATCAGGGTTTTGCAAGTGGTAGCCTA
GATGCAGATGCACAATCTGTTCGCATGTTTGTGGCAGATGGTGGCGAATG
CCTGGTAGCTCAGAGTTATGCGAAAAACATGGGACTCTATGGGGAACGTG
TCGGCGCCCTCAGCATTGTCTGCAAGACAGAAGATGTGGCAAGCAGGGTT
GAAAGCCAGTTGAAACTCGTGATTAGGCCCATGTACTCTAGTCCACCTAT
TCACGGGGCCTCTATTGTGGCTACAATTCTCAAGGACAGCACTATGTATA
AAGAGTGGACTCTTGAACTGAAAGCGATGGCTGACCGGATTATAAGCATG
CGTCAGCAACTATTTGATGCTCTGTCTGCTAGAGGCACTCCAGGAGACTG
GAGTCACATTATCAAGCAAATAGGAATGTTTACATTCACAGGGCTGAACA
GTGAACAAGTTGCCTTCATGACCAAGGAGTATCACATTTATATGACATCT
GATGGGAGGATTAGCATGGCAGGTCTTAGTTCAAAGACAGTTCCTCATCT
TACCGATGCTATACATGCTGCTGTAACCCGAATGGGCTAAGATTAATCAG
ACAAGAATTCATGCCGTAAGAATTGTTTGGTTTTCAGTCACCCTCAGCAA
TGCAAAAATGAGTTTGTAGAACTAGAAAATGCATAAATAAAGGTTTTACA
TTA
back to top