DC900088

Overview
NameDC900088
Unique NameDC900088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1103
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2287 contig Csv1_Contig2287:180..1282. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_MACFA (Aspartate aminotransferase, cytoplasmic OS=Macaca fascicularis GN=GOT1 PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 1.050e-92
Identity = 165/334 (49.40%), Postives = 234/334 (70.06%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-----QLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +F   +++L LG DSPA+K+ RV  VQ L GTG+LR+GA+FLAR Y+        +Y+  PTW NH  VF+ AG   +++YRY+D   RGL+ QG L DL  AP  +I++LHACAHNPTG DPT EQW+QI  +M+ + L PFFDSAYQGFASG+L+ DA ++R FV++G E   AQS++KN GLY ERVG L++V K  +   RV SQ++ ++R  +S+PP  GA IVA  L +  +++EW   +K MADRI++MR +L   L A  TPG W+HI  QIGMF++TGLN +QV ++  E HIY+   GRI+++GL++K + ++  +IH A+T++
Sbjct:   79 EFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIIVLHACAHNPTGTDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILRVLSQMEKIVRITWSNPPAQGARIVADTLSNPELFEEWKGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSYTGLNPKQVEYLINEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAITKI 412          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_SCHPO (Aspartate aminotransferase, mitochondrial OS=Schizosaccharomyces pombe GN=aat1 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.469e-86
Identity = 158/326 (48.47%), Postives = 218/326 (66.87%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSA-RGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVT 978
            F   + KL  G    +IKD R+ + Q +SGTG+L + A FLA  Y   TIY+  PTWGNH  VF+ AGL+VK+Y+YYDPATRGL+ +G+L DL +AP G+I+LLHACAHNPTGVDPT  QW+ I + M+ K      D AYQGFASG    DA + R+F +     L+ QS+AKNMGLYGER G  SI+    + A+R+ESQ K++IR +YS+PP++GA I   IL +  + ++W  E+  M++R+ SMR+ L + L         W HI  QIGMF +TGLN +QV  + K+YHIY+T +GRIS++GL++  V +  +AI+A  +
Sbjct:  112 FRVQATKLAYGDVYESIKD-RLVSAQSISGTGALCIAANFLASFYPSKTIYVSDPTWGNHKNVFSRAGLTVKSYKYYDPATRGLDIKGMLSDLTSAPDGSIILLHACAHNPTGVDPTKAQWDDILKTMQKKNHFALLDMAYQGFASGDFARDAYATRLFASSNVPMLLCQSFAKNMGLYGERAGCFSILANDAEEAARIESQTKILIRALYSNPPVNGARIANHILSNPALREQWAGEVVGMSERLKSMRKALRNILEKDLKNKHSWKHITDQIGMFCYTGLNPQQVDVLAKQYHIYLTKNGRISISGLNTSNVRYFAEAINAVTS 436          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_CAEEL (Probable aspartate aminotransferase, cytoplasmic OS=Caenorhabditis elegans GN=T01C8.5 PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 6.823e-84
Identity = 154/325 (47.38%), Postives = 214/325 (65.85%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLS-VKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            F K + +L+LGA+SPAIK+ R   VQCLSGTG+LR GAEFLA   +  T+Y+  PTWGNH  VF  AG + V  Y ++D   + ++ +  L DL +AP  ++++LH CAHNPTG+DPT EQW+ + ++++ K L  FFD AYQGFASG   ADA ++R FV  G E +V+QS+AKN GLY ERVG L++V     V +  +SQ+ LVIR  +S+PP HGA IV  +L      ++W   ++AM+ RI  MR  L   L   GTPG W HII+QIGMF++TGL S QV  +   + +++  DGRI++ GL++K V ++  AI   V
Sbjct:   77 FRKAATELVLGAESPAIKEERSFGVQCLSGTGALRAGAEFLASVCNMKTVYVSNPTWGNHKLVFKKAGFTTVADYTFWDYDNKRVHIEKFLSDLESAPEKSVIILHGCAHNPTGMDPTQEQWKLVAEVIKRKNLFTFFDIAYQGFASGDPAADAWAIRYFVDQGMEMVVSQSFAKNFGLYNERVGNLTVVVNNPAVIAGFQSQMSLVIRANWSNPPAHGARIVHKVLTTPARREQWNQSIQAMSSRIKQMRAALLRHLMDLGTPGTWDHIIQQIGMFSYTGLTSAQVDHLIANHKVFLLRDGRINICGLNTKNVEYVAKAIDETV 401          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT_HAEIN (Aspartate aminotransferase OS=Haemophilus influenzae GN=aspC PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 5.060e-79
Identity = 145/321 (45.17%), Postives = 204/321 (63.55%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI 963
            D+N+ +  L+ G DS  I+ NR  TVQ L GTG+LR+ AEF+ R      ++I  PTW NH  +F   G++++ YRYYD   + L+++ LLEDL  A  G +VLLH C HNPTG+DPT EQW+++  L    G LP FD AYQG A+G LD DA  +R F A+  E LVA S++KN GLY ERVGA ++V +  ++AS   +Q+K +IR +YS+P  HG + VAT+L D+ + +EW  EL  M +RI  MR      L   G   D+S II+Q GMF+F+GL  EQV  +  E+ IY    GRI++AG++   + +L ++I
Sbjct:   73 DYNEQTKALLFGKDSEVIQSNRARTVQSLGGTGALRIAAEFIKRQTKAQNVWISTPTWPNHNAIFNAVGMTIREYRYYDAERKALDWEHLLEDLSQASEGDVVLLHGCCHNPTGIDPTPEQWQELAALSAKNGWLPLFDFAYQGLANG-LDEDAYGLRAFAANHKELLVASSFSKNFGLYNERVGAFTLVAENAEIASTSLTQVKSIIRTLYSNPASHGGATVATVLNDAQLRQEWENELTEMRERIKKMRHLFVQLLKEYGAEQDFSFIIEQNGMFSFSGLTGEQVDRLKNEFAIYAVRSGRINVAGITEDNIRYLCESI 392          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT_ECOLI (Aspartate aminotransferase OS=Escherichia coli (strain K12) GN=aspC PE=1 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 1.628e-77
Identity = 147/325 (45.23%), Postives = 199/325 (61.23%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            +F + + +L+ G  S  I D R  T Q   GTG+LRV A+FLA++     +++  P+W NH  VF  AGL V+ Y YYD     L+F  L+  L  A +G +VL H C HNPTG+DPTLEQW+ + QL   KG LP FD AYQGFA G L+ DA+ +R F A   E +VA SY+KN GLY ERVGA ++V    +   R  SQ+K  IR  YS+PP HGAS+VATIL +  +   W  EL  M  RI  MRQ   + L  +G   D+S IIKQ GMF+F+GL  EQV  + +E+ +Y  + GR+++AG++   +  L +AI A +
Sbjct:   73 EFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARG-LEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_SCHPO (Aspartate aminotransferase, cytoplasmic OS=Schizosaccharomyces pombe GN=aat2 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 2.126e-77
Identity = 146/330 (44.24%), Postives = 210/330 (63.64%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLT---IYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            F K +A+++   +   + ++RV ++Q +SGTG+  + A F+   Y + T   +YI  PTW  H  ++   G++V TY Y+D   R  +++G+L  +++AP G+I LLHACAHNPTG+DPT EQW  I + + S+  L  FD AYQGFASG L+ D+ ++  FV    +  V QS+AKNMGLYGER G +  V K     ++V SQL +V R   S+PP +GA I A IL    ++ EW  +LK M+ RII MR++L D+L A  TPG W HI +QIGMF+FTGL   QV F  + YH+Y +++GRISMAGL++  V H+  A + AV  +
Sbjct:   79 FTKAAAEVLFRPNPHLLSEDRVASMQSVSGTGANFLAASFIETFYVKHTGAHVYISNPTWPVHRTLWEKLGVTVDTYPYWDAKNRSFDYEGMLSTIKSAPEGSIFLLHACAHNPTGIDPTREQWLSIFESLLSRKHLVVFDIAYQGFASGDLNRDSWALNEFVKYNKDFFVCQSFAKNMGLYGERTGCMHYVAKDASTKNKVLSQLCIVQRNTISNPPAYGARIAAEILNSPQLFAEWEQDLKTMSSRIIEMRKRLRDSLVALKTPGSWDHITQQIGMFSFTGLTPAQVQFCQERYHLYFSANGRISMAGLNNSNVEHVAQAFNHAVREL 408          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: TYRB_SALTY (Aromatic-amino-acid aminotransferase OS=Salmonella typhimurium GN=tyrB PE=3 SV=3)

HSP 1 Score: 286.96 bits (733), Expect = 1.378e-76
Identity = 139/319 (43.57%), Postives = 205/319 (64.26%), Query Frame = 1
Query:   19 AKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            A L+ GAD P ++  RV T+Q L G+G+L+VGA+FL R++    +++  PTW NH  +F  AG  V TY +YD AT G+ F  LL  L   P+ +IVLLH C HNPTG D T  QW+ + ++++++ L+PF D AYQGF +G +D DA  +R   + G   LV+ S++K   LYGERVG LS+VC+  ++A+RV  QLK  +R +YSSPP  GA +VAT+L D  +   W  E+ AM +RIISMRQ L   L A     ++ ++++Q GMF++TGL+ EQV  +  E+ +Y+ + GR+ +AGL++  V  +  A  A +
Sbjct:   80 APLLFGADHPVLQQQRVATIQTLGGSGALKVGADFLKRYFPDAGVWVSDPTWENHIAIFAGAGFEVSTYPWYDDATNGIRFNDLLATLNTLPARSIVLLHPCCHNPTGADLTPSQWDAVIEIVKARDLIPFLDIAYQGFGAG-MDDDAYVIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVVCEDAEIAARVLGQLKATVRRIYSSPPCFGAQVVATVLGDEALKAGWLAEVDAMRNRIISMRQTLVKELKAEMPDRNFDYLLQQRGMFSYTGLSEEQVDRLRDEFGVYLIASGRMCVAGLNASNVHRVAKAFAAVM 397          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT_PSEAE (Aspartate aminotransferase OS=Pseudomonas aeruginosa GN=aspC PE=3 SV=2)

HSP 1 Score: 285.804 bits (730), Expect = 3.070e-76
Identity = 144/314 (45.86%), Postives = 206/314 (65.61%), Query Frame = 1
Query:   22 KLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI 963
            KL+ G +S  +   RV T Q + GTG+L++GA+FL R     T+ I  P+W NH  +F  AG  V+ YRYYD A+ G+N  GLLEDL A P+ +IV+LHAC HNPTGVD  L+ W+Q+  ++++KG +PF D AYQGF +G ++ DA +VR+F   G    V+ S++K+  LYGERVGALSIV ++ D ++RV SQ+K VIR  YS+PP HGAS+V+++L    +   W  EL  M DRI  MR  + + L+A G   D+S + +Q GMF+++GL ++QV  +  E+ IY  S GRI +A L+   +  +T AI
Sbjct:   82 KLLFGNESELLAAGRVVTTQAVGGTGALKLGADFLKRLLPDATVAISDPSWENHRALFEAAGFPVQNYRYYDAASNGVNRAGLLEDLNALPARSIVVLHACCHNPTGVDLELDDWKQVLDVLKAKGHVPFLDIAYQGFGNG-IEEDAAAVRLFAQSGLSFFVSSSFSKSFSLYGERVGALSIVTESRDESARVLSQVKRVIRTNYSNPPTHGASVVSSVLNSPELRALWEQELGEMRDRIRDMRLAMVEQLAAHGAKRDFSFVGRQRGMFSYSGLTADQVERLKTEFGIYAVSTGRICVAALNKSNLETITKAI 394          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT_SALTI (Aspartate aminotransferase OS=Salmonella typhi GN=aspC PE=3 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 6.839e-76
Identity = 145/325 (44.62%), Postives = 199/325 (61.23%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            +F + + +L+ G  S  I D R  T Q   GTG+LR+ A+FLA++     +++  P+W NH  VF  AGL V+ Y YYD     L+F+ L   L  A +G +VL H C HNPTG+DPTLEQW+ + +L   KG LP FD AYQGFA G L+ DA+ +R F A   E +VA SY+KN GLY ERVGA ++V    +   R  SQ+K  IR  YS+PP HGASIVATIL +  +   W  EL  M  RI  MRQ   + L  +G   D+S IIKQ GMF+F+GL  +QV  + +E+ +Y  + GR+++AG++   +  L +AI A +
Sbjct:   73 EFARCTQELLFGKGSALINDKRARTAQTPGGTGALRIAADFLAKNTPVKRVWVSNPSWPNHKSVFNAAGLEVREYAYYDAENHSLDFEALQASLSEAQAGDVVLFHGCCHNPTGIDPTLEQWQVLAELSVEKGWLPLFDFAYQGFARG-LEEDAEGLRAFAALHKELIVASSYSKNFGLYNERVGACTLVAADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKDQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT_SALTY (Aspartate aminotransferase OS=Salmonella typhimurium GN=aspC PE=3 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 1.166e-75
Identity = 145/325 (44.62%), Postives = 199/325 (61.23%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAV 975
            +F + + +L+ G  S  I D R  T Q   GTG+LR+ A+FLA++     +++  P+W NH  VF  AGL V+ Y YYD     L+F+ L   L  A +G +VL H C HNPTG+DPTLEQW+ + +L   KG LP FD AYQGFA G L+ DA+ +R F A   E +VA SY+KN GLY ERVGA ++V    +   R  SQ+K  IR  YS+PP HGASIVATIL +  +   W  EL  M  RI  MRQ   + L  +G   D+S IIKQ GMF+F+GL  +QV  + +E+ +Y  + GR+++AG++   +  L +AI A +
Sbjct:   73 EFARCTQELLFGKGSALINDKRARTAQTPGGTGALRIAADFLAKNTPVKRVWVSNPSWPNHKSVFNAAGLEVREYAYYDAENHTLDFEALQASLSEAQAGDVVLFHGCCHNPTGIDPTLEQWQVLAELSVEKGWLPLFDFAYQGFARG-LEEDAEGLRAFAALHKELIVASSYSKNFGLYNERVGACTLVAADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKDQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396          
The following BLAST results are available for this feature:
BLAST of DC900088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
AATC_MACFA1.050e-9249.40Aspartate aminotransferase, cytoplasmic OS=Macaca ... [more]
AATM_SCHPO1.469e-8648.47Aspartate aminotransferase, mitochondrial OS=Schiz... [more]
AATC_CAEEL6.823e-8447.38Probable aspartate aminotransferase, cytoplasmic O... [more]
AAT_HAEIN5.060e-7945.17Aspartate aminotransferase OS=Haemophilus influenz... [more]
AAT_ECOLI1.628e-7745.23Aspartate aminotransferase OS=Escherichia coli (st... [more]
AATC_SCHPO2.126e-7744.24Aspartate aminotransferase, cytoplasmic OS=Schizos... [more]
TYRB_SALTY1.378e-7643.57Aromatic-amino-acid aminotransferase OS=Salmonella... [more]
AAT_PSEAE3.070e-7645.86Aspartate aminotransferase OS=Pseudomonas aerugino... [more]
AAT_SALTI6.839e-7644.62Aspartate aminotransferase OS=Salmonella typhi GN=... [more]
AAT_SALTY1.166e-7544.62Aspartate aminotransferase OS=Salmonella typhimuri... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900088 VSS Citrus sinensis cDNA clone VS27V02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900088 ID=DC900088|Name=DC900088|organism=Citrus sinensis|type=EST|length=1103bp
GATTTTAATAAATTGAGTGCAAAGCTCATCCTTGGTGCTGACAGCCCTGC
GATTAAAGACAACAGAGTGACCACCGTTCAGTGCTTGTCTGGCACTGGTT
CTTTGAGGGTTGGAGCTGAGTTTCTGGCAAGGCATTATCACCAACTTACC
ATATATATTCCACAGCCAACATGGGGAAACCATCCCAAAGTTTTCACTTT
AGCAGGATTGTCTGTGAAGACCTACCGCTATTATGATCCAGCAACACGTG
GGCTAAACTTCCAAGGCTTGCTGGAGGATCTTAGGGCTGCACCATCCGGA
GCTATAGTTCTTCTTCATGCATGTGCTCATAATCCAACTGGTGTTGACCC
GACCCTTGAGCAGTGGGAGCAGATCAGGCAGCTGATGAGGTCAAAAGGAT
TGTTACCTTTCTTTGACAGTGCTTATCAGGGTTTTGCAAGTGGTAGCCTA
GATGCAGATGCACAATCTGTTCGCATGTTTGTGGCAGATGGTGGCGAATG
CCTGGTAGCTCAGAGTTATGCGAAAAACATGGGACTCTATGGGGAACGTG
TCGGCGCCCTCAGCATTGTCTGCAAGACAGAAGATGTGGCAAGCAGGGTT
GAAAGCCAGTTGAAACTCGTGATTAGGCCCATGTACTCTAGTCCACCTAT
TCACGGGGCCTCTATTGTGGCTACAATTCTCAAGGACAGCACTATGTATA
AAGAGTGGACTCTTGAACTGAAAGCGATGGCTGACCGGATTATAAGCATG
CGTCAGCAACTATTTGATGCTCTGTCTGCTAGAGGCACTCCAGGAGACTG
GAGTCACATTATCAAGCAAATAGGAATGTTTACATTCACAGGGCTGAACA
GTGAACAAGTTGCCTTCATGACCAAGGAGTATCACATTTATATGACATCT
GATGGGAGGATTAGCATGGCAGGTCTTAGTTCAAAGACAGTTCCTCATCT
TACCGATGCTATACATGCTGCTGTAACCCGAATGGGCTAAGATTAATCAG
ACAAGAATTCATGCCGTAAGAATTGTTTGGTTTTCAGTCACCCTCAGCAA
TGCAAAAATGAGTTTGTAGAACTAGAAAATGCATAAATAAAGGTTTTACA
TTA
back to top