DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_HYPMO (60S ribosomal protein L15 OS=Hypophthalmichthys molitrix GN=rpl15 PE=2 SV=3)

HSP 1 Score: 226.868 bits (577), Expect = 1.268e-58
Identity = 117/186 (62.90%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQS+VMRFL RVRCW+YRQ  S+ R  RPTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +SVAEERAGR  GGLRVLNSYW+ EDSTYK+FEVIL+D  H AIR +P   W+   V KHRE+RGLTSAGKK RGL GKGH  H     SRRA WKR NT
Sbjct:   13 KKQSNVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVRKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWKRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_PARDA (60S ribosomal protein L15 OS=Paramisgurnus dabryanus GN=rpl15 PE=2 SV=3)

HSP 1 Score: 225.713 bits (574), Expect = 2.825e-58
Identity = 116/186 (62.37%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            KKQSDVMRFL RVRCW+YRQ  S+ R  +PTRPDKARRLGYKAKQ                   KG  YGKP + GV Q+KF RS +S AEERAGR  GGLRVL+SYW+ EDSTYK+FEVILVD  H AIR +P   W+   VHKHRE+RGLTSAGKK RGL GKGH  H     SRRA W+R NT
Sbjct:   13 KKQSDVMRFLLRVRCWQYRQLSSLHRTPKPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSTAEERAGRHCGGLRVLSSYWVGEDSTYKFFEVILVDIFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGL-GKGHKFHLTIGGSRRAAWRRRNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_DICDI (60S ribosomal protein L15 OS=Dictyostelium discoideum GN=rpl15-1 PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.825e-58
Identity = 116/186 (62.37%), Postives = 128/186 (68.82%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKG-HLHHKARPSRRATWKRNNT 570
            KKQSD +RFL RVRCWEYR  P   R + PTR DKARRLGYKA Q                    G   GKP   GV +LK  R+ RSVAEER GR+   LRVLNSYW+N+DSTYKY+EVILVD +HNAIRNDPR NW+C PVHKHRELRGLTSAG K RGLR KG H   K RPSR+A +KR NT
Sbjct:   13 KKQSDAVRFLLRVRCWEYRNLPVCHRASHPTRVDKARRLGYKATQGFVVYRIRVRRGGRKRQVPGGRTGGKPKTHGVNELKPSRNLRSVAEERVGRRCPNLRVLNSYWVNQDSTYKYYEVILVDNSHNAIRNDPRYNWICKPVHKHRELRGLTSAGIKARGLRRKGTHRASKTRPSRQANYKRRNT 198          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_ANOGA (60S ribosomal protein L15 OS=Anopheles gambiae GN=RpL15 PE=2 SV=3)

HSP 1 Score: 225.328 bits (573), Expect = 3.689e-58
Identity = 113/185 (61.08%), Postives = 131/185 (70.81%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKA-RPSRRATWKRNN 567
            KKQSDVMR+L R+R W+YRQ     R  RP+RPDKARRLGYKAKQ                   KG  YGKP + GV QLK  R  +SVAEER GR+LGGLRVLNSYW+ +D+ +KYFEVI+VDPAHNAIR DP +NW+CN VHKHRELRGLTSAGK  RGL GKG+ + +    SRRA W+R N
Sbjct:   13 KKQSDVMRYLLRIRVWQYRQMTRFHRAPRPSRPDKARRLGYKAKQGFSIFRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRCLQSVAEERVGRRLGGLRVLNSYWVAQDAAHKYFEVIMVDPAHNAIRRDPNVNWICNAVHKHRELRGLTSAGKSSRGL-GKGYRYSQTIGGSRRACWRRRN 196          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15B_SCHPO (60S ribosomal protein L15-B OS=Schizosaccharomyces pombe GN=rpl15b PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.689e-58
Identity = 114/185 (61.62%), Postives = 130/185 (70.27%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 570
            KKQSDV  FL RVR WEYRQ   I R +RP+RPDKARRLGYKAKQ                   KG  YGKP +QGV  LK+QRS R  AEER GR    LRVLNSYW+N+D+TYK+FEVILVDP+H AIR DPRINW+ NPVHKHRE RGLTS GKK RG+ GKGH ++ +   + ATW R+NT
Sbjct:   13 KKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGQTYGKPVHQGVNHLKYQRSARCTAEERVGRYCSNLRVLNSYWVNQDATYKFFEVILVDPSHKAIRRDPRINWIVNPVHKHRESRGLTSIGKKSRGI-GKGHRYNNS--PQHATWLRHNT 194          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_CHITE (60S ribosomal protein L15 OS=Chironomus tentans GN=RpL15 PE=3 SV=3)

HSP 1 Score: 224.172 bits (570), Expect = 8.219e-58
Identity = 109/185 (58.92%), Postives = 133/185 (71.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKA-RPSRRATWKRNN 567
            KKQSDV+R+L RVRCW+YRQ   + R  RP+RPDKARRLGYKAKQ                   KG  YGKP + GV QLK  R+ +SVAEER GR++GGLRVLNSYW+ +D+ +KY+EVI VDP HNA+R DP++NW+CN VHKHRELRGLTSAGK  RG+ GKG+ + +    SRRA W+R N
Sbjct:   13 KKQSDVLRYLLRVRCWQYRQLTKLHRAPRPSRPDKARRLGYKAKQGFLIYRIRVRRGGRKRPVHKGCTYGKPKSHGVNQLKPYRNLQSVAEERVGRRMGGLRVLNSYWVAQDAAFKYYEVICVDPFHNAVRRDPKVNWVCNAVHKHRELRGLTSAGKSSRGV-GKGYRYSQTIGGSRRAAWRRKN 196          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15A_SCHPO (60S ribosomal protein L15-A OS=Schizosaccharomyces pombe GN=rpl15a PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 8.219e-58
Identity = 114/185 (61.62%), Postives = 129/185 (69.73%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 570
            KKQSDV  FL RVR WEYRQ   I R +RP+RPDKARRLGYKAKQ                   KG  YGKP +QGV  LK+QRS R  AEER GR    LRVLNSYW+N+D+TYK+FEVILVDP+H AIR DPRINW+ NPVHKHRE RGLTS GKK RG+ GKGH  + +   + ATW R+NT
Sbjct:   13 KKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGQTYGKPVHQGVNHLKYQRSARCTAEERVGRYCSNLRVLNSYWVNQDATYKFFEVILVDPSHKAIRRDPRINWIVNPVHKHRESRGLTSIGKKSRGI-GKGHRFNNS--PQHATWLRHNT 194          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_DROME (60S ribosomal protein L15 OS=Drosophila melanogaster GN=RpL15 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 9.087e-57
Identity = 111/185 (60.00%), Postives = 131/185 (70.81%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKA-RPSRRATWKRNN 567
            KKQSDVMR+L R+R W+YRQ   + R  RPTRPDKARRLGY+AKQ                   KG  YGKP + GV QLK  R  +S+AEER GR+LGGLRVLNSYWI +D++YKYFEVIL+D  H+AIR DP+INW+C  VHKHRELRGLTSAGK  RG+ GKG+ + +    SRRA WKR N
Sbjct:   13 KKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGI-GKGYRYSQTIGGSRRAAWKRKN 196          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_ORCLI (60S ribosomal protein L15 OS=Orconectes limosus GN=RPL15 PE=2 SV=3)

HSP 1 Score: 208.379 bits (529), Expect = 4.667e-53
Identity = 104/185 (56.22%), Postives = 122/185 (65.95%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 570
            KKQSDVMRFL R+R W+YR    + R  RPTRP+KARRLGYKAKQ                   KG  YGKP + GV QLK  R+ +S+AEER GR+LGGLRVLNSYW+ +DSTYKYFEVILVD  HN IR    +NW+C    KHRE+RG TSAG+K+RGL    H       SRR+ W R+NT
Sbjct:   13 KKQSDVMRFLLRIRAWQYRHLNKLHRAPRPTRPEKARRLGYKAKQGFVIYRIRIRRGGRKRPVPKGATYGKPKSHGVNQLKPTRNLQSLAEERTGRRLGGLRVLNSYWVAQDSTYKYFEVILVDIRHNVIRKSGSLNWICKHTQKHREMRGKTSAGRKHRGLGRGFHYSQTKGGSRRSCWLRHNT 197          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_CAEEL (60S ribosomal protein L15 OS=Caenorhabditis elegans GN=rpl-15 PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.025e-52
Identity = 104/186 (55.91%), Postives = 125/186 (67.20%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA-TWKRNNT 570
            KKQSD +R+L R+R W YRQ  ++ RV RPTRP+KARRLGY+AKQ                   KG  YGKP   GV +LK  +SK++VAE RAGR+LG LRVLNSYW+ EDSTYK++EV+L+DP H AIR +P   W+  PVHKHRE RGLTSAG+K RGL GKG      R   +A  WKR NT
Sbjct:   13 KKQSDALRYLLRIRTWHYRQLSAVHRVPRPTRPEKARRLGYRAKQGFVVYRVRVRRGNRKRPVCKGQTYGKPKTHGVNELKNAKSKQAVAEGRAGRRLGSLRVLNSYWVAEDSTYKFYEVVLIDPFHKAIRRNPDTQWITKPVHKHREQRGLTSAGRKSRGL-GKGWRFSATRGGSQAKNWKRKNT 197          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15_HYPMO1.268e-5862.9060S ribosomal protein L15 OS=Hypophthalmichthys mo... [more]
RL15_PARDA2.825e-5862.3760S ribosomal protein L15 OS=Paramisgurnus dabryan... [more]
RL15_DICDI2.825e-5862.3760S ribosomal protein L15 OS=Dictyostelium discoid... [more]
RL15_ANOGA3.689e-5861.0860S ribosomal protein L15 OS=Anopheles gambiae GN=... [more]
RL15B_SCHPO3.689e-5861.6260S ribosomal protein L15-B OS=Schizosaccharomyces... [more]
RL15_CHITE8.219e-5858.9260S ribosomal protein L15 OS=Chironomus tentans GN... [more]
RL15A_SCHPO8.219e-5861.6260S ribosomal protein L15-A OS=Schizosaccharomyces... [more]
RL15_DROME9.087e-5760.0060S ribosomal protein L15 OS=Drosophila melanogast... [more]
RL15_ORCLI4.667e-5356.2260S ribosomal protein L15 OS=Orconectes limosus GN... [more]
RL15_CAEEL3.025e-5255.9160S ribosomal protein L15 OS=Caenorhabditis elegan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top