DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_CHICK (60S ribosomal protein L15 (Fragment) OS=Gallus gallus GN=RPL15 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.405e-49
Identity = 99/158 (62.66%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  100 RPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            RPTRPDKARRLGYKAKQ                   KG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW+ EDSTYK+FEVIL+DP H  IR +P   W+  PVHKHRE+RGLTSAG+K RGL GKGH  HH    SRRA W+R NT
Sbjct:    2 RPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKRIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHKFHHTIGGSRRAAWRRRNT 158          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_PIG (60S ribosomal protein L15 (Fragment) OS=Sus scrofa GN=RPL15 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 7.468e-43
Identity = 88/147 (59.86%), Postives = 98/147 (66.67%), Query Frame = 1
Query:  133 GYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGH-LHHKARPSRRATWKRNNT 570
            GYKAKQ                   KG  YGKP + GV QLKF RS +SV EERAGR  G LRVLNSYW+ EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL GKGH  HH    SRRA W+R NT
Sbjct:    1 GYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVXEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHKFHHTIGGSRRAAWRRRNT 146          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METJA (50S ribosomal protein L15e OS=Methanocaldococcus jannaschii GN=rpl15e PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.969e-36
Identity = 84/181 (46.41%), Postives = 108/181 (59.67%), Query Frame = 1
Query:   19 KQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            K+S V + L   R  ++R+ P++VR+ RPTR D+AR LGYK KQ                   K     KP   GV ++   +S + +AEERA RK   + VLNSYW+ ED  +K++EVILVDP H AI+ DP++NWLC   H+ R  RGLTSAGKK RGLR KG    K RPS RA  +R
Sbjct:   15 KESYVRQLLWE-RLQQWRREPAVVRIERPTRLDRARALGYKPKQGIIVVRVRVRRGGLRKPRPKNSK--KPATLGVNKITMGKSIQRIAEERAARKYPNMEVLNSYWVGEDGKHKWYEVILVDPYHPAIKADPQLNWLCTGKHRGRAFRGLTSAGKKGRGLRNKGIGAEKVRPSIRAHGRR 192          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_THEON (50S ribosomal protein L15e OS=Thermococcus onnurineus (strain NA1) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 3.360e-35
Identity = 82/180 (45.56%), Postives = 109/180 (60.56%), Query Frame = 1
Query:   10 RGKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +  K+S V + L++ R  ++R+ P +VRV RPTR D+AR LGY+AKQ                   KG    KP+  G+ +   ++S + +AEE+A RK   L VLNSYW+ ED  YK+FEVI+VDP H  I++DP+I W+    HK R  RGLTSAG+K RGLR KG    K RPS RA
Sbjct:   12 KSPKKSYVGQLLKK-RMIKWRREPVVVRVERPTRLDRARSLGYQAKQGYVIVRVRVRRGGRKRPRWKG--GRKPSKMGMVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIAGKAHKGRVFRGLTSAGRKSRGLRNKGKGAEKVRPSVRA 188          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_THEGJ (50S ribosomal protein L15e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 4.389e-35
Identity = 82/180 (45.56%), Postives = 108/180 (60.00%), Query Frame = 1
Query:   10 RGKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +  K+S V   L++ R  ++R+ P +VR+ RPTR D+AR LGY+AKQ                   KG    KP+  G+ +   ++S + +AEE+A RK   L VLNSYW+ ED  YK+FEVI+VDP H  I++DP+I W+    HK R  RGLTSAGKK RGLR KG    K RPS RA
Sbjct:   12 KSPKKSYVGELLKK-RMIKWRREPVVVRIERPTRLDRARSLGYQAKQGYVVVRVRVRRGGRKRPRWKG--GRKPSKMGMVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWITGKAHKGRVFRGLTSAGKKGRGLRNKGKGAEKVRPSVRA 188          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METM5 (50S ribosomal protein L15e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 4.389e-35
Identity = 79/173 (45.66%), Postives = 101/173 (58.38%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            LQ  R  ++R+ PS++R+ RPTR D+AR LGYKAKQ                   K     KP   G+ ++   +S + +AEERA +K   + VLNSYW+ +D   K++EVILVDP   +I+ND   NWLC   HK R  RGLTSAGKK RGL  KG    KARPS RA  K+
Sbjct:   22 LQWARMQDWRKEPSVIRIERPTRIDRARNLGYKAKQGIVVVRVSVRRGGLRKPRPKHSK--KPATMGINKITMAKSIQRIAEERAAKKYPNMEVLNSYWVGQDGKQKWYEVILVDPCQPSIKNDKSYNWLCKGTHKGRVTRGLTSAGKKGRGLMYKGKGAEKARPSVRANGKK 192          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_QUESU (60S ribosomal protein L15 OS=Quercus suber GN=RPL15 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 5.732e-35
Identity = 86/184 (46.74%), Postives = 101/184 (54.89%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNN 567
            +KQSDV+RFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQ                   KG  +GKP NQG+ QLKFQRS RS AEER  R+ GGLR+LNSYWI +  +    +  L  P+       P       P      L      GK+ RGL G+G  H K+     A WKR N
Sbjct:   13 RKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGNRKRPAPKGATFGKPVNQGINQLKFQRSLRSTAEERVARRCGGLRILNSYWITKTVSTSTLKSSLSTPSTRLSVVMPVSTGSATPYTSAENLAVSHPLGKQNRGL-GRGSKHTKS--PNHAFWKRTN 193          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_PYRHO (50S ribosomal protein L15e OS=Pyrococcus horikoshii GN=rpl15e PE=3 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 9.777e-35
Identity = 83/180 (46.11%), Postives = 109/180 (60.56%), Query Frame = 1
Query:   10 RGKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +  K+S V + L++ R  ++R+ PS+VR+ RPTR D+AR LGY+AKQ                   KG    KP+  G  +   ++S + +AEE+A RK   L VLNSYW+ ED  YK+FEVI+VDP H  I++DP+I W+    HK R  RGLTSAGKK RGLR KG    K RPS RA
Sbjct:   12 KSPKKSYVGQLLKQ-RMIKWRREPSVVRIERPTRLDRARALGYQAKQGYIIVRVRVRRGGRKRPRWKG--GRKPSKMGQVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIALKHHKGRVFRGLTSAGKKGRGLRNKGKGAEKIRPSIRA 188          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_PYRAB (50S ribosomal protein L15e OS=Pyrococcus abyssi GN=rpl15e PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.178e-34
Identity = 82/180 (45.56%), Postives = 109/180 (60.56%), Query Frame = 1
Query:   10 RGKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +  K+S V + L++ R  ++R+ P++VR+ RPTR D+AR LGY+AKQ                   KG    KP+  G  +   ++S + +AEE+A RK   L VLNSYW+ ED  YK+FEVI+VDP H  I++DP+I W+    HK R  RGLTSAGKK RGLR KG    K RPS RA
Sbjct:   12 KSPKKSYVGQLLKQ-RMIKWRREPAVVRIERPTRLDRARALGYQAKQGYVIVRVRVRRGGRKRPRWKG--GRKPSKMGQVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIALKHHKGRVFRGLTSAGKKGRGLRNKGKGAEKIRPSIRA 188          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_PYRFU (50S ribosomal protein L15e OS=Pyrococcus furiosus GN=rpl15e PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.852e-34
Identity = 82/180 (45.56%), Postives = 107/180 (59.44%), Query Frame = 1
Query:   10 RGKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +  K+S V   L++ R  ++R+ P +VR+ RPTR D+AR LGY+AKQ                   KG    KP+  G  +   ++S + +AEE+A RK   L VLNSYW+ ED  YK+FEVI+VDP H  I++DP+I W+    HK R  RGLTSAGKK RGLR KG    K RPS RA
Sbjct:   12 KSPKKSYVGELLKQ-RMIKWRREPVVVRIERPTRLDRARALGYQAKQGYVIVRVRVRKGGRKRPRWKG--GRKPSKMGQVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIALKHHKGRVFRGLTSAGKKGRGLRNKGKGAEKVRPSIRA 188          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15_CHICK1.405e-4962.6660S ribosomal protein L15 (Fragment) OS=Gallus gal... [more]
RL15_PIG7.468e-4359.8660S ribosomal protein L15 (Fragment) OS=Sus scrofa... [more]
RL15E_METJA3.969e-3646.4150S ribosomal protein L15e OS=Methanocaldococcus j... [more]
RL15E_THEON3.360e-3545.5650S ribosomal protein L15e OS=Thermococcus onnurin... [more]
RL15E_THEGJ4.389e-3545.5650S ribosomal protein L15e OS=Thermococcus gammato... [more]
RL15E_METM54.389e-3545.6650S ribosomal protein L15e OS=Methanococcus maripa... [more]
RL15_QUESU5.732e-3546.7460S ribosomal protein L15 OS=Quercus suber GN=RPL1... [more]
RL15E_PYRHO9.777e-3546.1150S ribosomal protein L15e OS=Pyrococcus horikoshi... [more]
RL15E_PYRAB2.178e-3445.5650S ribosomal protein L15e OS=Pyrococcus abyssi GN... [more]
RL15E_PYRFU4.852e-3445.5650S ribosomal protein L15e OS=Pyrococcus furiosus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top