DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METM7 (50S ribosomal protein L15e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.852e-34
Identity = 79/173 (45.66%), Postives = 101/173 (58.38%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            LQ  R  ++R+ PS++RV RPTR D+AR LGYKAKQ                   K     KP+  G+ ++   +S + +AEERA +K   L VLNSYW+ +D   K++EVILVD  H +I++D   NWLC   HK R  RGLTSAGKK RGL  KG    K RPS RA  K+
Sbjct:   22 LQWSRMQDWRKEPSVIRVERPTRIDRARNLGYKAKQGIVVVRVSVRRGGLRKPRPKHSK--KPSTLGINKITMAKSIQRIAEERAAKKYPNLEVLNSYWVGQDGKQKWYEVILVDSCHPSIKSDKSYNWLCKGTHKGRATRGLTSAGKKGRGLMYKGKGTEKVRPSVRANSKK 192          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METM6 (50S ribosomal protein L15e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.852e-34
Identity = 79/173 (45.66%), Postives = 101/173 (58.38%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            LQ  R  ++R+ PS++RV RPTR D+AR LGYKAKQ                   K     KP+  G+ ++   +S + +AEERA +K   L VLNSYW+ +D   K++EVILVD  H +I++D   NWLC   HK R  RGLTSAGKK RGL  KG    K RPS RA  K+
Sbjct:   22 LQWSRMQDWRKEPSVIRVERPTRIDRARNLGYKAKQGIVVVRVSVRRGGLRKPRPKHSK--KPSTLGINKITMAKSIQRIAEERAAKKYPNLEVLNSYWVGQDGKQKWYEVILVDSCHPSIKSDKSYNWLCKGTHKGRATRGLTSAGKKGRGLMYKGKGAEKVRPSVRANSKK 192          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_PYRKO (50S ribosomal protein L15e OS=Pyrococcus kodakaraensis GN=rpl15e PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.844e-33
Identity = 79/180 (43.89%), Postives = 106/180 (58.89%), Query Frame = 1
Query:   10 RGKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +  K+S V   L++ R  ++R+ P + R+ RPTR D+AR LGY+AKQ                   KG    KP+  G+ +   ++S + +AEE+A RK   L VLNSYW+ ED  YK+FEVI+VDP H  I++DP+I W+    HK R  RGLTSAGK+ RGL  KG    K RPS RA
Sbjct:   12 KSPKKSYVGELLKK-RMIQWRRDPVVKRIERPTRLDRARSLGYQAKQGYVVVRVRVRRGGRKRPRWKG--GRKPSKMGMVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIAGKAHKGRVFRGLTSAGKRSRGLLNKGKGAEKVRPSIRA 188          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METMP (50S ribosomal protein L15e OS=Methanococcus maripaludis GN=rpl15e PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.039e-32
Identity = 75/173 (43.35%), Postives = 100/173 (57.80%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            LQ  R  ++R+ PS++R+ RPTR D+AR LGYKAKQ                   K     KP   G+ ++   +S + +AEERA ++   + VLNSYW+ +D   K++E+ILVDP H +I+ND   +WL    HK R  RGLTSAGKK RGL  KG    KARP  RA  K+
Sbjct:   22 LQWARMQDWRKEPSVLRIERPTRIDRARNLGYKAKQGIVVVRVSVRRGGLRKPRPKHSK--KPATLGINKITMAKSIQRIAEERAAKRYPNMEVLNSYWVGQDGKQKWYEIILVDPCHPSIKNDKSYSWLSTGNHKGRANRGLTSAGKKGRGLMYKGKGAEKARPGVRANGKK 192          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_DESK1 (50S ribosomal protein L15e OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.541e-32
Identity = 82/186 (44.09%), Postives = 106/186 (56.99%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG----KGHLHHKARPSRRATWKR 561
            K++S  +  L R R  E+R+ PS+VR+ +PTR DKAR LGYKAK                          +P   GV      +S R +AEERA RK  GL VLNSY++ ED  YK++EVILVDP H +I NDP +NW+C P ++ R  RGLTSAGKK RGLR     +G +++K        WKR
Sbjct:   14 KEKSRELEALIRQRLIEWRREPSVVRLEKPTRLDKARALGYKAKVGFIIVRVRVRKGGQRKPRPDS--GRRPKRMGVYGYAPAKSLRLIAEERAARKFPGLEVLNSYYVAEDGRYKWYEVILVDPHHPSICNDPDVNWICEPQNRGRVFRGLTSAGKKMRGLRKSRGLRGTVYYK--------WKR 189          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METKA (50S ribosomal protein L15e OS=Methanopyrus kandleri GN=rpl15e PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.931e-32
Identity = 77/173 (44.51%), Postives = 99/173 (57.23%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            L + R  ++R+ PS+ R+ RPTR ++ARRLGY+AK                    K     +P   G  +    +SK+ +AEERA RK   L VLNSYW+ ED  YKY+EVI+VDP H  I++D RINW+C    K R  RG T AGKK RGLR +G    K RPS RA  +R
Sbjct:   25 LLKERLPKWRKGPSVQRIKRPTRIERARRLGYRAKPGYVVVRVRVPKGGRRKSRPKK--GRRPKRMGKNKFSPGKSKQWIAEERAQRKYPNLEVLNSYWVGEDGQYKYYEVIMVDPYHPQIKSDHRINWICQKSQKGRVFRGKTGAGKKARGLRKRGKGAEKVRPSLRAHRRR 195          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_HALSA (50S ribosomal protein L15e OS=Halobacterium salinarium GN=rpl15e PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 7.747e-32
Identity = 79/177 (44.63%), Postives = 104/177 (58.76%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 570
            LQ  R  ++R+  +I RV RPTR DKAR LGYKAKQ                   K    G+ T  QGV ++   ++ + +AEERA RK   LR LNSYW+ ED + K+FE IL+DP H AI+ND  +NW+C+  HK+R  RG TSAG++ RGL+ +G      RPS  A  KRN +
Sbjct:   24 LQWQRKQDWRKEGAIERVDRPTRLDKARELGYKAKQGVVVVRVSVRKGTARKSRFKA---GRRTKRQGVNRIGRAKNLQRIAEERASRKYVNLRTLNSYWVGEDGSQKWFEAILLDPEHGAIQNDDDLNWICDDSHKNRVFRGKTSAGRRARGLQNRGKGTEGLRPSTNAD-KRNKS 196          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_HALS3 (50S ribosomal protein L15e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 7.747e-32
Identity = 79/177 (44.63%), Postives = 104/177 (58.76%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 570
            LQ  R  ++R+  +I RV RPTR DKAR LGYKAKQ                   K    G+ T  QGV ++   ++ + +AEERA RK   LR LNSYW+ ED + K+FE IL+DP H AI+ND  +NW+C+  HK+R  RG TSAG++ RGL+ +G      RPS  A  KRN +
Sbjct:   24 LQWQRKQDWRKEGAIERVDRPTRLDKARELGYKAKQGVVVVRVSVRKGTARKSRFKA---GRRTKRQGVNRIGRAKNLQRIAEERASRKYVNLRTLNSYWVGEDGSQKWFEAILLDPEHGAIQNDDDLNWICDDSHKNRVFRGKTSAGRRARGLQNRGKGTEGLRPSTNAD-KRNKS 196          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_STAMF (50S ribosomal protein L15e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.726e-31
Identity = 79/177 (44.63%), Postives = 100/177 (56.50%), Query Frame = 1
Query:   34 MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            M  L R R  ++R+ P+I+R+ +PTR D+AR LGYKAKQ                    KG    +P   G+      +S R +AEERA RK   L VLNSY++ ED  YK++EVILVDP H AI NDP I W+C   H+ R  RGLTSAGKK RGLR    L +    + +  WKR
Sbjct:   21 MLTLMRQRLIKWRREPAIIRIEKPTRLDRARALGYKAKQGFIIVRVRVRKGGLRKQRPNKG---RRPKRMGIYGFAPSKSLRLIAEERAARKYPNLEVLNSYYVGEDGNYKWYEVILVDPHHPAICNDPDIKWICEKQHRRRVFRGLTSAGKKMRGLRKSRGLKY----TIKYKWKR 190          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_AERPE (50S ribosomal protein L15e OS=Aeropyrum pernix GN=rpl15e PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.254e-31
Identity = 81/172 (47.09%), Postives = 100/172 (58.14%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLH--HKARPSRRA 549
            L + R  E+R+ PSI+RV +PTR D+AR LGYKAKQ                    KG    +P   GV      +S R +AEERA RK   L VLNSY++ ED  YK++EVILVDP H AI+NDP +NW+    HK R  RGLTSAGKK RGLR    L   HK +  ++A
Sbjct:   24 LMKARLLEWRRQPSILRVEKPTRLDRARALGYKAKQGVIVARVRVRKGGRRKPRPNKG---RRPKRMGVYGFAPAKSLRLIAEERAQRKYPNLVVLNSYYVGEDGRYKWYEVILVDPNHPAIKNDPELNWVTTGKHKGRPFRGLTSAGKKMRGLRKSRGLKGTHKYKWKKKA 192          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15E_METM74.852e-3445.6650S ribosomal protein L15e OS=Methanococcus maripa... [more]
RL15E_METM64.852e-3445.6650S ribosomal protein L15e OS=Methanococcus maripa... [more]
RL15E_PYRKO1.844e-3343.8950S ribosomal protein L15e OS=Pyrococcus kodakarae... [more]
RL15E_METMP2.039e-3243.3550S ribosomal protein L15e OS=Methanococcus maripa... [more]
RL15E_DESK14.541e-3244.0950S ribosomal protein L15e OS=Desulfurococcus kamc... [more]
RL15E_METKA5.931e-3244.5150S ribosomal protein L15e OS=Methanopyrus kandler... [more]
RL15E_HALSA7.747e-3244.6350S ribosomal protein L15e OS=Halobacterium salina... [more]
RL15E_HALS37.747e-3244.6350S ribosomal protein L15e OS=Halobacterium salina... [more]
RL15E_STAMF1.726e-3144.6350S ribosomal protein L15e OS=Staphylothermus mari... [more]
RL15E_AERPE2.254e-3147.0950S ribosomal protein L15e OS=Aeropyrum pernix GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top