DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_NATPD (50S ribosomal protein L15e OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.558e-31
Identity = 76/173 (43.93%), Postives = 101/173 (58.38%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            LQ  R  E+R   +I R+ RPTR DKAR LGYKAKQ                   K     K   QGV ++  +++ + +AEER+GRK   LRVLNSYW+ ED + K+FEVIL+DP H AI+ND  ++W+C+   + R  RG TSAG++ RG + +G      RPS RA  KR
Sbjct:   24 LQWQRQQEWRDQGAIERIERPTRLDKARSLGYKAKQGVVVARVSVRKGTARKQRFKAGRRSK--RQGVNKITRRKNLQRIAEERSGRKFRNLRVLNSYWVGEDGSQKWFEVILLDPEHGAIQNDDDLSWICDDSQRGRAYRGRTSAGQRGRGQQKRGKGTEHTRPSIRANDKR 194          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_HALWD (50S ribosomal protein L15e OS=Haloquadratum walsbyi (strain DSM 16790) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.461e-30
Identity = 75/167 (44.91%), Postives = 96/167 (57.49%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPS 540
            LQ  R  E+R   +IVR+ RPTR DKAR LGYKAKQ                   K    G+ +  QGV +L  + S + +AEERA RK   LR L SYW+ ED + K+ E+IL+DP H AI ND  +NW+C+  HK R  RGLT+AG+  RGL+ +G      RPS
Sbjct:   24 LQWQRKQEWRDQGAIVRIDRPTRLDKARELGYKAKQGVIIARVAVRKGGARK---KRFTSGRRSKRQGVNRLGRRTSIQRIAEERAARKYPNLRTLASYWVGEDGSQKWHEIILIDPEHAAIENDDDLNWICDDTHKGRAFRGLTNAGRSNRGLQNRGKGAEHTRPS 187          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METTH (50S ribosomal protein L15e OS=Methanobacterium thermoautotrophicum GN=rpl15e PE=3 SV=3)

HSP 1 Score: 133.265 bits (334), Expect = 1.908e-30
Identity = 73/167 (43.71%), Postives = 95/167 (56.89%), Query Frame = 1
Query:   34 MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKAR 534
            +R L   R  ++R+ P I R+ RPTR D+AR LGY+AK                    K     +PT  GV ++   +S + +AEER  RK   + VLNSYW+ ED  YK++EVILVDP H AI+NDP+I W+C   H+ R  RGL S GKK RGLR +G    K R
Sbjct:   18 VRELMWERAPKWRRDPVIKRIERPTRIDRARALGYRAKPGYIVVRTRVRRGSQRKTRFKA--GRRPTRMGVKKITTAKSIKRIAEERVARKYPNMEVLNSYWVWEDGKYKFYEVILVDPNHLAIKNDPKIYWICVKQHRGRVFRGLISEGKKNRGLRNRGKGAEKVR 182          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_HALLT (50S ribosomal protein L15e OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.492e-30
Identity = 78/166 (46.99%), Postives = 94/166 (56.63%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPS 540
            LQ  R  E+R   +I R+ RPTR DKAR LGYKAKQ                   K     K   QGV +L  ++S + ++EERA RK   LRVLNSYW+ ED + K+ EVILVDP H AI ND  + W+ +  HK R  RGLTSAG K RG R +G    K RPS
Sbjct:   24 LQWQRKQEWRDEGAIERIERPTRLDKARELGYKAKQGVVVARVSVRKGGSRKQRHKAGRRSK--RQGVNRLSRRKSIQRISEERASRKYRNLRVLNSYWVGEDGSQKWHEVILVDPNHPAIENDGDLGWIASDDHKGRAFRGLTSAGTKGRGQRTRGTGTEKTRPS 187          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METST (50S ribosomal protein L15e OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.251e-30
Identity = 74/165 (44.85%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   43 LQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGK-PTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKAR 534
            L R R  ++R+ P I+R+ +PTR D+ARRLGYKAK                    K    G+ P   GV ++  ++S + +AEER  RK   L VLNSYW+ ED   KY+EVILVDP   +I++D +INW+C+  H  R  RGLTSAGKK RGL  KG    K R
Sbjct:   25 LMRERLPKWRRQPVIIRIDKPTRIDRARRLGYKAKTGYVVARIRVRRGSRRKSRFKN---GRDPKRMGVNKISGEKSIQRMAEERVARKYPNLEVLNSYWVWEDGKAKYYEVILVDPQCPSIQHDNKINWICSKKHTRRAFRGLTSAGKKGRGLNKKGKGAEKVR 186          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METHJ (50S ribosomal protein L15e OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.251e-30
Identity = 77/170 (45.29%), Postives = 97/170 (57.06%), Query Frame = 1
Query:   55 RCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPT-NQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            R  ++R+  SIVRV RPTR D+AR LGYKAKQ                      V G+ T   GV +    +S + +AEERA RK   + VLNSYW+ ED   K++EVIL+DP H +I ND  +NW+  P H+ R  RGLTSAG K RG+R +G    K RPS RA   R
Sbjct:   28 RMQDWRREGSIVRVRRPTRIDRARALGYKAKQGIVVVRVKVRRGGRRASRY---VRGRRTARMGVNRKTMGKSIQRIAEERACRKYPNMEVLNSYWVGEDGRQKWYEVILLDPHHPSIINDKTLNWISKPGHRGRSERGLTSAGVKGRGMRRRGKGTEKCRPSVRANANR 194          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METBU (50S ribosomal protein L15e OS=Methanococcoides burtonii (strain DSM 6242) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.700e-29
Identity = 70/174 (40.23%), Postives = 99/174 (56.90%), Query Frame = 1
Query:   46 QRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQ-GVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN 564
            +R++ W  R+  S+ RV RPTR D+AR LGYKAKQ                      + G+ T   G  ++   +S + ++EERA RK   + VLNSYW+ ED   K++EVILVDP+H  I++D  +NW+C   H  R  RG TSAG+K RG++ +G    K RPS R+   R+
Sbjct:   27 ERLQVW--RKEGSVTRVERPTRIDRARSLGYKAKQGIVVARVKVRRGSMRKSRY---IRGRRTQHTGKNKITVGKSIQRISEERAARKYPNMEVLNSYWVGEDGKQKWYEVILVDPSHPVIKSDKNLNWICGKAHSGRVFRGKTSAGRKGRGMQTRGTGTEKTRPSVRSNLNRS 195          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULIY (50S ribosomal protein L15e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.016e-29
Identity = 74/165 (44.85%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG----KGHLHHK 528
            R R  E+R+ PSIVR+ +PTR ++AR LGYKAKQ                    KG    +P   GV      +  + +AEERA RK   L VL SY++ ED  YKY+E+I+VDP+H  I+NDP   WL +P +++R  RGLTSAGKK RGLR     KG + HK
Sbjct:   24 RQRFIEWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKG---RRPKRMGVYGYGPAKGYKWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIIMVDPSHPVIKNDPNYKWLQDPSNRNRVFRGLTSAGKKARGLRKSKGFKGTVKHK 185          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULIN (50S ribosomal protein L15e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.016e-29
Identity = 74/165 (44.85%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG----KGHLHHK 528
            R R  E+R+ PSIVR+ +PTR ++AR LGYKAKQ                    KG    +P   GV      +  + +AEERA RK   L VL SY++ ED  YKY+E+I+VDP+H  I+NDP   WL +P +++R  RGLTSAGKK RGLR     KG + HK
Sbjct:   24 RQRFIEWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKG---RRPKRMGVYGYGPAKGYKWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIIMVDPSHPVIKNDPNYKWLQDPSNRNRVFRGLTSAGKKARGLRKSKGFKGTVKHK 185          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULIM (50S ribosomal protein L15e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.016e-29
Identity = 74/165 (44.85%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG----KGHLHHK 528
            R R  E+R+ PSIVR+ +PTR ++AR LGYKAKQ                    KG    +P   GV      +  + +AEERA RK   L VL SY++ ED  YKY+E+I+VDP+H  I+NDP   WL +P +++R  RGLTSAGKK RGLR     KG + HK
Sbjct:   24 RQRFIEWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKG---RRPKRMGVYGYGPAKGYKWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIIMVDPSHPVIKNDPNYKWLQDPSNRNRVFRGLTSAGKKARGLRKSKGFKGTVKHK 185          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15E_NATPD6.558e-3143.9350S ribosomal protein L15e OS=Natronomonas pharaon... [more]
RL15E_HALWD1.461e-3044.9150S ribosomal protein L15e OS=Haloquadratum walsby... [more]
RL15E_METTH1.908e-3043.7150S ribosomal protein L15e OS=Methanobacterium the... [more]
RL15E_HALLT2.492e-3046.9950S ribosomal protein L15e OS=Halorubrum lacusprof... [more]
RL15E_METST4.251e-3044.8550S ribosomal protein L15e OS=Methanosphaera stadt... [more]
RL15E_METHJ7.251e-3045.2950S ribosomal protein L15e OS=Methanospirillum hun... [more]
RL15E_METBU4.700e-2940.2350S ribosomal protein L15e OS=Methanococcoides bur... [more]
RL15E_SULIY8.016e-2944.8550S ribosomal protein L15e OS=Sulfolobus islandicu... [more]
RL15E_SULIN8.016e-2944.8550S ribosomal protein L15e OS=Sulfolobus islandicu... [more]
RL15E_SULIM8.016e-2944.8550S ribosomal protein L15e OS=Sulfolobus islandicu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top